Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	122970
Gene name	Acyl-CoA thioesterase 4
Gene symbol	ACOT4
Synonyms (NCBI Gene)	PTE-IbPTE1BPTE2B
Chromosome	14
Chromosome location	14q24.3

Show/Hide all (2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016879	hsa-miR-335-5p	Microarray	18185580
MIRT025674	hsa-miR-7-5p	Microarray	17612493

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000038	Process	Very long-chain fatty acid metabolic process	IDA	16940157
GO:0001676	Process	Long-chain fatty acid metabolic process	IDA	16940157
GO:0004778	Function	Succinyl-CoA hydrolase activity	IDA	16141203
GO:0004778	Function	Succinyl-CoA hydrolase activity	IEA
GO:0005777	Component	Peroxisome	IBA
GO:0005777	Component	Peroxisome	IDA	16141203, 16940157
GO:0005777	Component	Peroxisome	IEA
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006104	Process	Succinyl-CoA metabolic process	IDA	16940157
GO:0006104	Process	Succinyl-CoA metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IBA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006637	Process	Acyl-CoA metabolic process	IBA
GO:0006637	Process	Acyl-CoA metabolic process	IDA	16940157
GO:0006637	Process	Acyl-CoA metabolic process	IEA
GO:0006637	Process	Acyl-CoA metabolic process	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0016790	Function	Thiolester hydrolase activity	IEA
GO:0019605	Process	Butyrate metabolic process	IDA	16940157
GO:0032787	Process	Monocarboxylic acid metabolic process	IEA
GO:0032788	Process	Saturated monocarboxylic acid metabolic process	IDA	16940157
GO:0032789	Process	Unsaturated monocarboxylic acid metabolic process	IDA	16940157
GO:0043648	Process	Dicarboxylic acid metabolic process	IDA	16940157
GO:0043648	Process	Dicarboxylic acid metabolic process	IEA
GO:0043649	Process	Dicarboxylic acid catabolic process	IDA	16141203
GO:0046459	Process	Short-chain fatty acid metabolic process	IDA	16940157
GO:0046459	Process	Short-chain fatty acid metabolic process	IEA
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	IBA
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	IDA	16141203, 16940157
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	IEA
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	TAS
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA

MIM	HGNC	e!Ensembl
614314	19748	ENSG00000177465

Q8N9L9

Protein name

Peroxisomal succinyl-coenzyme A thioesterase (EC 3.1.2.3) (Acyl-coenzyme A thioesterase 4) (Acyl-CoA thioesterase 4) (EC 3.1.2.2) (PTE-2b) (Peroxisomal acyl coenzyme A thioester hydrolase Ib) (Peroxisomal long-chain acyl-CoA thioesterase Ib) (PTE-Ib)

Protein function

Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels (PubMed:16940157). Functions as a peroxisomal succinyl-coenzyme A thioesterase that can also hydrolyze glutaryl-

PDB

3K2I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04775	Bile_Hydr_Trans	16 → 141	Acyl-CoA thioester hydrolase/BAAT N-terminal region	Family
PF08840	BAAT_C	203 → 412	BAAT / Acyl-CoA thioester hydrolase C terminal	Domain

Tissue specificity

TISSUE SPECIFICITY: Strongest expression in liver and kidney and weaker expression in placenta, heart, and muscle. {ECO:0000269|PubMed:16940157}.

Sequence

MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGEL
DLERAPALGGSFAGLEPMGLLWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLL
CQAQHERHFLPPGVRRQSVRAGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAG
HGFATLALAYYNFEDLPNNMDNISLEYFEEAVCYMLQHPQVKGPGIGLLGISLGADICLS
MASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLRRIKVAFSGLVDIVDIRNALV
GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKPQIICYPGTGH
YIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPK
L

Sequence length

421

Interactions

View interactions

	KEGG		Reactome
	Fatty acid elongation Biosynthesis of unsaturated fatty acids Metabolic pathways Ovarian steroidogenesis		Beta-oxidation of very long chain fatty acids Peroxisomal protein import

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Cerebral Infarction	Ischemic stroke	Pubtator	25961151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25961151		★★★★★ ★☆☆☆☆ Found in Text Mining only

ACOT4 (acyl-CoA thioesterase 4)