Gene Gene information from NCBI Gene database.
Entrez ID 122809
Gene name Suppressor of cytokine signaling 4
Gene symbol SOCS4
Synonyms (NCBI Gene)
SOCS7
Chromosome 14
Chromosome location 14q22.3
Summary The protein encoded by this gene contains a SH2 domain and a SOCS BOX domain. The protein thus belongs to the suppressor of cytokine signaling (SOCS), also known as STAT-induced STAT inhibitor (SSI), protein family. SOCS family members are known to be cyt
miRNA miRNA information provided by mirtarbase database.
696
miRTarBase ID miRNA Experiments Reference
MIRT005326 hsa-miR-98-5p Luciferase reporter assayNorthern blotqRT-PCRWestern blot 20486857
MIRT005326 hsa-miR-98-5p Luciferase reporter assayNorthern blotqRT-PCRWestern blot 20486857
MIRT020274 hsa-miR-130b-3p Sequencing 20371350
MIRT025579 hsa-miR-34a-5p Sequencing 20371350
MIRT005326 hsa-miR-98-5p Reporter assay;Western blot;qRT-PCR;Other 20486857
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25814554, 32296183, 32814053
GO:0007175 Process Negative regulation of epidermal growth factor-activated receptor activity IDA 15590694
GO:0009968 Process Negative regulation of signal transduction IEA
GO:0016567 Process Protein ubiquitination IEA
GO:0019221 Process Cytokine-mediated signaling pathway IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616337 19392 ENSG00000180008
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WXH5
Protein name Suppressor of cytokine signaling 4 (SOCS-4) (Suppressor of cytokine signaling 7) (SOCS-7)
Protein function SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. Substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which
PDB 2IZV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12610 SOCS 58 111 Suppressor of cytokine signalling Family
PF00017 SH2 286 364 SH2 domain Domain
PF07525 SOCS_box 386 422 SOCS box Domain
Sequence
MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEV
SLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSR
HSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRRN
MEENINCFSHTNVQPCVITTDNALCREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWDLDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHY
KDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EY
HYKSKVRVLRIDAPEQQC
Sequence length 440
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  JAK-STAT signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Type II diabetes mellitus
 
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTOIMMUNE DISEASE GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Allergic rhinitis (disorder) Allergic rhinitis BEFREE 29545878
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 25286386 Associate
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 25286386 Stimulate
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 25639832
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Breast Carcinoma Breast Carcinoma BEFREE 25162020
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 20433750, 34120621 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 35624501 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 17717605, 39307915 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma CTD_human_DG 30365097
★☆☆☆☆
Found in Text Mining only
Cirrhosis Cirrhosis BEFREE 23164156
★☆☆☆☆
Found in Text Mining only