Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	122416
Gene name	Ankyrin repeat domain 9
Gene symbol	ANKRD9
Synonyms (NCBI Gene)	-
Chromosome	14
Chromosome location	14q32.31

Show/Hide all (92)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019583	hsa-miR-340-5p	Sequencing	20371350
MIRT674039	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT674038	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT674037	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT674036	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT674035	hsa-miR-3666	HITS-CLIP	23824327
MIRT674034	hsa-miR-4295	HITS-CLIP	23824327
MIRT674033	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT674032	hsa-miR-652-3p	HITS-CLIP	23824327
MIRT674031	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT674030	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT674029	hsa-miR-3135b	HITS-CLIP	23824327
MIRT674028	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT023278	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT674027	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT674026	hsa-miR-4284	HITS-CLIP	23824327
MIRT674025	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT674024	hsa-miR-3652	HITS-CLIP	23824327
MIRT674023	hsa-miR-4430	HITS-CLIP	23824327
MIRT674022	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT674021	hsa-miR-8057	HITS-CLIP	23824327
MIRT671160	hsa-miR-6514-5p	HITS-CLIP	23824327
MIRT671159	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT671158	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT671157	hsa-miR-4770	HITS-CLIP	23824327
MIRT671156	hsa-miR-6088	HITS-CLIP	23824327
MIRT671155	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT671154	hsa-miR-1273f	HITS-CLIP	23824327
MIRT671153	hsa-miR-924	HITS-CLIP	23824327
MIRT671152	hsa-miR-4534	HITS-CLIP	23824327
MIRT671151	hsa-miR-8082	HITS-CLIP	23824327
MIRT671150	hsa-miR-1289	HITS-CLIP	23824327
MIRT671149	hsa-miR-4294	HITS-CLIP	23824327
MIRT671148	hsa-miR-431-5p	HITS-CLIP	23824327
MIRT671147	hsa-miR-3198	HITS-CLIP	23824327
MIRT671146	hsa-miR-4309	HITS-CLIP	23824327
MIRT642524	hsa-miR-587	HITS-CLIP	23824327
MIRT671145	hsa-miR-8055	HITS-CLIP	23824327
MIRT671144	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT642527	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT642526	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT642525	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT642524	hsa-miR-587	HITS-CLIP	23824327
MIRT674039	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT674038	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT674037	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT674036	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT674035	hsa-miR-3666	HITS-CLIP	23824327
MIRT674034	hsa-miR-4295	HITS-CLIP	23824327
MIRT674033	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT674032	hsa-miR-652-3p	HITS-CLIP	23824327
MIRT674031	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT674030	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT674029	hsa-miR-3135b	HITS-CLIP	23824327
MIRT674028	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT023278	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT674027	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT674026	hsa-miR-4284	HITS-CLIP	23824327
MIRT674025	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT674024	hsa-miR-3652	HITS-CLIP	23824327
MIRT674023	hsa-miR-4430	HITS-CLIP	23824327
MIRT674022	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT674021	hsa-miR-8057	HITS-CLIP	23824327
MIRT671160	hsa-miR-6514-5p	HITS-CLIP	23824327
MIRT671159	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT671158	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT671157	hsa-miR-4770	HITS-CLIP	23824327
MIRT671156	hsa-miR-6088	HITS-CLIP	23824327
MIRT671155	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT671154	hsa-miR-1273f	HITS-CLIP	23824327
MIRT671153	hsa-miR-924	HITS-CLIP	23824327
MIRT671152	hsa-miR-4534	HITS-CLIP	23824327
MIRT671151	hsa-miR-8082	HITS-CLIP	23824327
MIRT671150	hsa-miR-1289	HITS-CLIP	23824327
MIRT671149	hsa-miR-4294	HITS-CLIP	23824327
MIRT671148	hsa-miR-431-5p	HITS-CLIP	23824327
MIRT671147	hsa-miR-3198	HITS-CLIP	23824327
MIRT671146	hsa-miR-4309	HITS-CLIP	23824327
MIRT642524	hsa-miR-587	HITS-CLIP	23824327
MIRT671145	hsa-miR-8055	HITS-CLIP	23824327
MIRT671144	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT642527	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT642526	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT642525	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT642524	hsa-miR-587	HITS-CLIP	23824327
MIRT2172032	hsa-miR-3135	CLIP-seq
MIRT2172033	hsa-miR-3907	CLIP-seq
MIRT2172034	hsa-miR-4668-3p	CLIP-seq
MIRT2172035	hsa-miR-4738-5p	CLIP-seq
MIRT2443718	hsa-miR-2355-3p	CLIP-seq
MIRT2443719	hsa-miR-4646-3p	CLIP-seq
MIRT2443720	hsa-miR-4766-5p	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	30293565
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006878	Process	Intracellular copper ion homeostasis	IMP	24522796
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	IMP	30293565
GO:0031410	Component	Cytoplasmic vesicle	IDA	31337707
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IDA	30293565
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	30293565
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IMP	30293565

MIM	HGNC	e!Ensembl
618605	20096	ENSG00000156381

Q96BM1

Protein name

Ankyrin repeat domain-containing protein 9

Protein function

Substrate receptor subunit of a cullin-RING superfamily E3 ligase complex (CUL5-based E3 ubiquitin ligase complex) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:30293565). Depending of the me

Family and domains

Sequence

MPWDARRPGGGADGGPEASGAARSRAQKQCRKSSFAFYQAVRDLLPVWLLEDMRASEAFH
WDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCCAAPGPHVALA
VRYNRVGILRRILRTLRDFPAEERARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLG
HGASPGLRDGGGLTPLELLLRQLGRDAGATPSAAGAPASAPGEPRQRRLLLLDLLALYTP
VGAAGSARQELLGDRPRWQRLLGEDKFQWLAGLAPPSLFARAMQVLVTAISPGRFPEALD
ELPLPPFLQPLDLTGKG

Sequence length

317

Interactions

View interactions

	Reactome
			Neddylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30293565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30293565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30293565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30293565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30293565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ANKRD9 (ankyrin repeat domain 9)