Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	121643
Gene name	Forkhead box N4
Gene symbol	FOXN4
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12q24.11
Summary	Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-amino acid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helices flanked by 2 large loops

Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019471	hsa-miR-148b-3p	Microarray	17612493
MIRT024081	hsa-miR-1-3p	Microarray	18668037
MIRT040225	hsa-miR-615-3p	CLASH	23622248
MIRT1002835	hsa-miR-1245b-3p	CLIP-seq
MIRT1002836	hsa-miR-1289	CLIP-seq
MIRT1002837	hsa-miR-3165	CLIP-seq
MIRT1002838	hsa-miR-3180-5p	CLIP-seq
MIRT1002839	hsa-miR-3188	CLIP-seq
MIRT1002840	hsa-miR-330-3p	CLIP-seq
MIRT1002841	hsa-miR-3691-3p	CLIP-seq
MIRT1002842	hsa-miR-3941	CLIP-seq
MIRT1002843	hsa-miR-4294	CLIP-seq
MIRT1002844	hsa-miR-4299	CLIP-seq
MIRT1002845	hsa-miR-4423-5p	CLIP-seq
MIRT1002846	hsa-miR-4456	CLIP-seq
MIRT1002847	hsa-miR-4468	CLIP-seq
MIRT1002848	hsa-miR-466	CLIP-seq
MIRT1002849	hsa-miR-4672	CLIP-seq
MIRT1002850	hsa-miR-4731-3p	CLIP-seq
MIRT1002851	hsa-miR-4768-3p	CLIP-seq
MIRT1002852	hsa-miR-4801	CLIP-seq
MIRT1002853	hsa-miR-505	CLIP-seq
MIRT1002854	hsa-miR-520a-5p	CLIP-seq
MIRT1002855	hsa-miR-525-5p	CLIP-seq
MIRT1002856	hsa-miR-542-5p	CLIP-seq
MIRT1002857	hsa-miR-548q	CLIP-seq
MIRT1002858	hsa-miR-582-5p	CLIP-seq
MIRT1002859	hsa-miR-600	CLIP-seq
MIRT1002860	hsa-miR-665	CLIP-seq
MIRT1002861	hsa-miR-924	CLIP-seq
MIRT1997297	hsa-miR-148a	CLIP-seq
MIRT1997298	hsa-miR-148b	CLIP-seq
MIRT1997299	hsa-miR-152	CLIP-seq
MIRT1997300	hsa-miR-23a	CLIP-seq
MIRT1997301	hsa-miR-23b	CLIP-seq
MIRT1997302	hsa-miR-23c	CLIP-seq
MIRT1997303	hsa-miR-3192	CLIP-seq
MIRT1997304	hsa-miR-4519	CLIP-seq
MIRT1997305	hsa-miR-4661-5p	CLIP-seq
MIRT1997306	hsa-miR-4731-5p	CLIP-seq
MIRT1997307	hsa-miR-5096	CLIP-seq
MIRT1002837	hsa-miR-3165	CLIP-seq
MIRT1002841	hsa-miR-3691-3p	CLIP-seq
MIRT1002844	hsa-miR-4299	CLIP-seq
MIRT1002846	hsa-miR-4456	CLIP-seq
MIRT1002853	hsa-miR-505	CLIP-seq
MIRT1002857	hsa-miR-548q	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IBA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	22323600
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	ISS
GO:0001947	Process	Heart looping	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	ISS	22323600
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	27107012, 30177510, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0008016	Process	Regulation of heart contraction	ISS
GO:0010842	Process	Retina layer formation	IEA
GO:0010842	Process	Retina layer formation	ISS
GO:0021514	Process	Ventral spinal cord interneuron differentiation	IEA
GO:0021514	Process	Ventral spinal cord interneuron differentiation	ISS
GO:0035881	Process	Amacrine cell differentiation	IEA
GO:0035881	Process	Amacrine cell differentiation	ISS
GO:0036302	Process	Atrioventricular canal development	ISS
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048663	Process	Neuron fate commitment	IEA
GO:0060579	Process	Ventral spinal cord interneuron fate commitment	IEA
GO:0060579	Process	Ventral spinal cord interneuron fate commitment	ISS

MIM	HGNC	e!Ensembl
609429	21399	ENSG00000139445

Q96NZ1

Protein name

Forkhead box protein N4

Protein function

Transcription factor essential for neural and some non-neural tissues development, such as retina and lung respectively. Binds to an 11-bp consensus sequence containing the invariant tetranucleotide 5'-ACGC-3'. During development of the central

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00250	Forkhead	192 → 279	Forkhead domain	Domain

Sequence

MIESDTSSIMSGIIRNSGQNHHPSPQEYRLLATTSDDDLPGDLQSLSWLTAVDVPRLQQM
ASGRVDLGGPCVPHPHPGALAGVADLHVGATPSPLLHGPAGMAPRGMPGLGPITGHRDSM
SQFPVGGQPSSGLQDPPHLYSPATQPQFPLPPGAQQCPPVGLYGPPFGVRPPYPQPHVAV
HSSQELHPKHYPKPIYSYSCLIAMALKNSKTGSLPVSEIYSFMKEHFPYFKTAPDGWKNS
VRHNLSLNKCFEKVENKMSGSSRKGCLWALNLARIDKMEEEMHKWKRKDLAAIHRSMANP
EELDKLISDRPESCRRPGKPGEPEAPVLTHATTVAVAHGCLAVSQLPPQPLMTLSLQSVP
LHHQVQPQAHLAPDSPAPAQTPPLHALPDLSPSPLPHPAMGRAPVDFINISTDMNTEVDA
LDPSIMDFALQGNLWEEMKDEGFSLDTLGAFADSPLGCDLGASGLTPASGGSDQSFPDLQ
VTGLYTAYSTPDSVAASGTSSSSQYLGAQGNKPIALL

Sequence length

517

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	31430519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	36033826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31430519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31430519		★★★★★ ★☆☆☆☆ Found in Text Mining only

FOXN4 (forkhead box N4)