TPH2 (tryptophan hydroxylase 2)

Gene

• Entrez ID: 121278
• Gene name: Tryptophan hydroxylase 2
• Gene symbol: TPH2
• Synonyms (NCBI Gene): ADHD7, NTPH
• Chromosome: 12
• Chromosome location: 12q21.1
• Summary: This gene encodes a member of the pterin-dependent aromatic acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene may be

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs17110563	C>T	Risk-factor	Coding sequence variant, missense variant, genic downstream transcript variant
rs120074175	G>A	Risk-factor	Coding sequence variant, genic downstream transcript variant, missense variant
rs120074176	C>T	Risk-factor	Coding sequence variant, genic downstream transcript variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1449303	hsa-miR-154	CLIP-seq
MIRT1449304	hsa-miR-425	CLIP-seq
MIRT1449305	hsa-miR-642b	CLIP-seq
MIRT2355664	hsa-miR-3685	CLIP-seq
MIRT2355665	hsa-miR-384	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
REST	Activation	17613521

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004510	Function	Tryptophan 5-monooxygenase activity	IBA
GO:0004510	Function	Tryptophan 5-monooxygenase activity	IDA	37608910
GO:0004510	Function	Tryptophan 5-monooxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005829	Component	Cytosol	TAS
GO:0009072	Process	Aromatic amino acid metabolic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016714	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen	IEA
GO:0042427	Process	Serotonin biosynthetic process	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 607478
• HGNC: 20692
• e!Ensembl: ENSG00000139287

Protein

• UniProt ID: Q8IWU9
• Protein name: Tryptophan 5-hydroxylase 2 (EC 1.14.16.4) (Neuronal tryptophan hydroxylase) (Tryptophan 5-monooxygenase 2)
• PDB: 4V06, 7QRI, 7WIY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00351	Biopterin_H	152 → 482	Biopterin-dependent aromatic amino acid hydroxylase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Brain specific.
• Sequence:

  MQPAMMMFSSKYWARRGFSLDSAVPEEHQLLGSSTLNKPNSGKNDDKGNKGSSKREAATE
  SGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCECGKTEFN
  ELIQLLKFQTTIVTLNPPENIWTEEEELEDVPWFPRKISELDKCSHRVLMYGSELDADHP
  GFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYL
  KNFPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQ
  YIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFF
  TIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQEAYF
  VSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA
  LNKMNQYLGI

• Sequence length: 490

Pathways

KEGG:

Tryptophan metabolism
Folate biosynthesis
Metabolic pathways
Serotonergic synapse

Reactome:

Serotonin and melatonin biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANXIETY DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER WITH HYPERACTIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit-hyperactivity disorder, susceptibility to, 7	Uncertain significance; risk factor; Likely benign	ClinVar ClinVar, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar affective disorder, susceptibility to	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major depressive disorder	Uncertain significance; Likely benign	ClinVar ClinVar, Disgenet ClinVar, Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARANOID SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tryptophan 5-monooxygenase deficiency	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar depression, susceptibility to	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Agoraphobia	Agoraphobia	BEFREE	16401665		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28856708		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	31792153		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	20946355, 23239044, 23337130, 30554102		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial personality disorder	Pubtator	36094569	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	17176491, 20451217, 38093326	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	18801407, 19361870, 19588223, 21257271, 22835848, 23684859, 26232682, 29520738, 29935278, 31415826		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	18801407, 19361870, 19588223, 20331984, 21257271, 22835848, 22915309, 23510446, 23684859, 26232682, 29520738, 29935278, 31415826		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety disorder	Pubtator	19052197	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	27871272	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	16894395, 28630479, 37104367	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	15940290, 16116490, 18163388, 18213624, 18427560, 19270759, 20213726, 20446882, 20470849, 20921119, 21257271, 23461725, 25875332, 28630479, 31661370		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	20446882, 22361444, 22698779, 23628433, 29935278, 31220273		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	15768392, 16958027, 17346350, 22698779		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	15768392		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behavior Disorders	Behavior Disorders	BEFREE	23172723		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	16240163, 16436194, 16806105, 17015812, 17167340, 17768266, 17905754, 19352219, 19800079, 21085052, 21396719, 24196946, 25152196, 26365518, 30087403		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	17167340, 17905754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	17604842, 24136241	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21085052, 21396719, 21438144, 24196946, 25152196		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	18797398, 24136241		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	17768266, 19032968, 20451217, 25152196		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	20451217	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37789226	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	17768266, 25152196		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36472833	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	36657118	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	22921782		★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	BEFREE	31216212		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	39940809	Associate	★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	17176492	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	17176492, 29484259	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23300701	Associate	★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	20740293		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	18197083		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22921782		★☆☆☆☆ Found in Text Mining only
Dental Enamel Hypoplasia	Dental Enamel Hypoplasia	BEFREE	23182718		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	PSYGENET_DG	21492941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Neurotic	Mental Depression	CTD_human_DG	17950541		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	15941494, 16203956, 17239033, 17408646, 19125159, 19548263, 19679166, 20043001, 20515362, 21257271, 21765945, 21873838, 22721547, 22826344, 22868061, 23063133, 23467366, 23510446, 23547810, 25214390, 25955598, 26057341, 29314569, 29520738, 29625215, 29956632, 30519155, 31071306		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	17950541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	20451217, 21418060, 25540092, 29484259, 29952309	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	23063133, 24863038, 25089765, 25214390, 26057341		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	17604842, 27807918	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	CTD_human_DG	17950541		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36698149	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	29484259	Associate	★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	26167977		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	20946355, 23239044		★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	17950541		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	27217698	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	24491795		★☆☆☆☆ Found in Text Mining only
Facioscapulohumeral muscular dystrophy 1a	Facioscapulohumeral muscular dystrophy	Pubtator	32576619	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	21071507		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	LHGDN	17592484		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	16146581		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	15799788	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	17176492	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	27217698	Associate	★☆☆☆☆ Found in Text Mining only
Hyperphenylalaninaemia	Hyperphenylalaninemia	BEFREE	29520738		★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	21073637, 30309244		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	21073637	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	16806105, 17905754, 19352219		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	16806105, 17905754, 19352219		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	16806105, 17905754, 19352219		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	16806105, 17905754, 19352219		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	19352219		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	19352219		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	19352219		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	15124006, 15629698, 16192985, 16806105, 17217922, 17251907, 17692928, 18180764, 19120094, 19162119, 19272410, 19588223, 19590397, 19734157, 20738857, 21396719, 21620479, 21937687, 22693556, 23467366, 24376086, 25955598, 26057341, 26386440, 26745768, 27807918, 28084537, 28648567, 30519155, 30822678, 31019472		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Major Depressive Disorder	Mental Depression	PSYGENET_DG	23336047, 23467366, 24196946, 24376086, 26057341		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Major Depressive Disorder	Mental Depression	CTD_human_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	23182718		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	17950541		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	26013962	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	15941494, 16203956, 17239033, 17408646, 19125159, 19548263, 19679166, 20043001, 20515362, 21257271, 21765945, 21873838, 22721547, 22826344, 22868061, 23063133, 23467366, 23510446, 23547810, 25955598, 26057341, 29314569, 29520738, 29625215, 29956632, 30519155, 31071306		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23063133, 24863038, 25089765, 25214390, 26057341		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	17011525, 17015812, 17768266, 18797398, 19233335, 19588223, 19800079, 20043001, 21829912, 22915309, 28342337, 29775696, 31216212, 31319134		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	19125159		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19125159		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	19434366, 20740293		★☆☆☆☆ Found in Text Mining only
Minimal Brain Dysfunction	Minimal Brain Dysfunction	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	20451217, 31216212		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	15968084, 17015812, 17604842, 20874521, 21257271, 22649797, 24754353, 26167977, 29775696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	LHGDN	17015812		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	17176492, 21418060	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	20874521, 21257271, 21418060, 22649797, 24754353		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood swings	Mood swings	BEFREE	17176492		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	19763617		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22698518		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	17011525		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	22826343		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	21765945, 25455586		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22826343		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	16146581, 17346350, 18197083, 21829912, 23337130, 30554102		★☆☆☆☆ Found in Text Mining only
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	27871272		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	BEFREE	18832011		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	16401665, 17123728, 19132526, 21085052, 23552096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic Disorder	LHGDN	17123728		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic disorder	Pubtator	23552096	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	15363479, 22392150, 24668623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paranoid Schizophrenia	Paranoid Schizophrenia	PSYGENET_DG	22392150		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	21105877, 31077958		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	17123728		★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	17176492, 19894072, 20451217		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	22483952, 25014617, 25451452, 31291234		★☆☆☆☆ Found in Text Mining only
Primary Insomnia	Insomnia	BEFREE	29952309		★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	16436194, 25073638		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	24491795, 25073638		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23053960		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15840421, 16240163, 16436194, 20144688, 20623453, 20938755, 21396719, 21399903, 22655589, 28084537, 29775696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21399903, 25073638		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22655589, 28264500, 33986383	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia Paranoid	Schizophrenia	Pubtator	24668623	Associate	★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	24260145, 26167977		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	30827242		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	31071306		★☆☆☆☆ Found in Text Mining only
Stress Disorders, Traumatic	Stress Disorder	BEFREE	23435356		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	29484259	Associate	★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	23360517		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	15124006, 15629698, 16192985, 16806105, 17217922, 17251907, 17692928, 18180764, 19120094, 19162119, 19588223, 19590397, 19734157, 20738857, 21396719, 21620479, 21937687, 22693556, 23467366, 24376086, 25955598, 26386440, 27807918, 28084537, 30519155, 30822678, 31019472		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	CTD_human_DG	17950541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	23336047, 23467366, 24196946, 24376086, 26057341		★★☆☆☆ Found in Text Mining + Unknown/Other Associations