Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	121273
Gene name	Chromosome 12 open reading frame 54
Gene symbol	C12orf54
Synonyms (NCBI Gene)	HSD-29HSD-30
Chromosome	12
Chromosome location	12q13.11

15 Show/Hide all (15)

miRTarBase ID	miRNA	Experiments
MIRT831508	hsa-miR-34c-3p	CLIP-seq
MIRT831509	hsa-miR-3692	CLIP-seq
MIRT831510	hsa-miR-4690-3p	CLIP-seq
MIRT831511	hsa-miR-548b-3p	CLIP-seq
MIRT831512	hsa-miR-660	CLIP-seq
MIRT1946266	hsa-miR-4476	CLIP-seq
MIRT831511	hsa-miR-548b-3p	CLIP-seq
MIRT2445061	hsa-miR-1271	CLIP-seq
MIRT2445062	hsa-miR-182	CLIP-seq
MIRT2445063	hsa-miR-34a	CLIP-seq
MIRT2445064	hsa-miR-34c-5p	CLIP-seq
MIRT2445065	hsa-miR-449a	CLIP-seq
MIRT2445066	hsa-miR-449b	CLIP-seq
MIRT2445067	hsa-miR-502-5p	CLIP-seq
MIRT2445068	hsa-miR-96	CLIP-seq

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein name

Uncharacterized protein C12orf54

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15732	DUF4681	1 → 127	Domain of unknown function (DUF4681)	Family

Sequence

MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQED
ARIRGMSNCSMTPMTSAPRTGSIRPPDSLMTPKLRRLQFSSGEQPSGGRIHNLKTQLFSQ
SAYYPGP

Sequence length

127

Interactions

View interactions

Related Genes Genes most often co-reported with C12orf54 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for C12orf54.

Diseases Linked via Similar Genes Diseases curated for genes most similar to C12orf54 (see Related Genes above), that are NOT already directly curated for C12orf54 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to C12orf54.

C12orf54 (chromosome 12 open reading frame 54)