Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	121260
Gene name	Solute carrier family 15 member 4
Gene symbol	SLC15A4
Synonyms (NCBI Gene)	FP12591PHT1PTR4
Chromosome	12
Chromosome location	12q24.33

160

Show/Hide all (160)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002585	hsa-miR-124-3p	Microarray	15685193
MIRT002585	hsa-miR-124-3p	Microarray	15685193
MIRT002585	hsa-miR-124-3p	Microarray	18668037
MIRT044921	hsa-miR-186-5p	CLASH	23622248
MIRT038188	hsa-miR-151a-5p	CLASH	23622248
MIRT719400	hsa-miR-548c-3p	HITS-CLIP	19536157
MIRT719399	hsa-miR-4668-3p	HITS-CLIP	19536157
MIRT719398	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT719397	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT719400	hsa-miR-548c-3p	HITS-CLIP	19536157
MIRT719399	hsa-miR-4668-3p	HITS-CLIP	19536157
MIRT719398	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT719397	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT1352737	hsa-miR-1245b-3p	CLIP-seq
MIRT1352738	hsa-miR-127-5p	CLIP-seq
MIRT1352739	hsa-miR-134	CLIP-seq
MIRT1352740	hsa-miR-141	CLIP-seq
MIRT1352741	hsa-miR-15a	CLIP-seq
MIRT1352742	hsa-miR-15b	CLIP-seq
MIRT1352743	hsa-miR-16	CLIP-seq
MIRT1352744	hsa-miR-186	CLIP-seq
MIRT1352745	hsa-miR-195	CLIP-seq
MIRT1352746	hsa-miR-200a	CLIP-seq
MIRT1352747	hsa-miR-203	CLIP-seq
MIRT1352748	hsa-miR-23a	CLIP-seq
MIRT1352749	hsa-miR-23b	CLIP-seq
MIRT1352750	hsa-miR-23c	CLIP-seq
MIRT1352751	hsa-miR-299-5p	CLIP-seq
MIRT1352752	hsa-miR-3118	CLIP-seq
MIRT1352753	hsa-miR-3164	CLIP-seq
MIRT1352754	hsa-miR-383	CLIP-seq
MIRT1352755	hsa-miR-409-3p	CLIP-seq
MIRT1352756	hsa-miR-424	CLIP-seq
MIRT1352757	hsa-miR-4275	CLIP-seq
MIRT1352758	hsa-miR-4307	CLIP-seq
MIRT1352759	hsa-miR-4474-5p	CLIP-seq
MIRT1352760	hsa-miR-4501	CLIP-seq
MIRT1352761	hsa-miR-4652-3p	CLIP-seq
MIRT1352762	hsa-miR-4772-5p	CLIP-seq
MIRT1352763	hsa-miR-4775	CLIP-seq
MIRT1352764	hsa-miR-487b	CLIP-seq
MIRT1352765	hsa-miR-497	CLIP-seq
MIRT1352766	hsa-miR-548a-5p	CLIP-seq
MIRT1352767	hsa-miR-548ab	CLIP-seq
MIRT1352768	hsa-miR-548ak	CLIP-seq
MIRT1352769	hsa-miR-548b-5p	CLIP-seq
MIRT1352770	hsa-miR-548c-5p	CLIP-seq
MIRT1352771	hsa-miR-548d-5p	CLIP-seq
MIRT1352772	hsa-miR-548h	CLIP-seq
MIRT1352773	hsa-miR-548i	CLIP-seq
MIRT1352774	hsa-miR-548j	CLIP-seq
MIRT1352775	hsa-miR-548n	CLIP-seq
MIRT1352776	hsa-miR-548w	CLIP-seq
MIRT1352777	hsa-miR-548y	CLIP-seq
MIRT1352778	hsa-miR-559	CLIP-seq
MIRT1352779	hsa-miR-582-5p	CLIP-seq
MIRT1352780	hsa-miR-590-3p	CLIP-seq
MIRT1352781	hsa-miR-622	CLIP-seq
MIRT1352782	hsa-miR-922	CLIP-seq
MIRT1352783	hsa-miR-944	CLIP-seq
MIRT2104465	hsa-miR-1261	CLIP-seq
MIRT2104466	hsa-miR-3121-5p	CLIP-seq
MIRT2104467	hsa-miR-4448	CLIP-seq
MIRT1352781	hsa-miR-622	CLIP-seq
MIRT2328858	hsa-miR-101	CLIP-seq
MIRT2328859	hsa-miR-124	CLIP-seq
MIRT2328860	hsa-miR-1264	CLIP-seq
MIRT1352739	hsa-miR-134	CLIP-seq
MIRT1352740	hsa-miR-141	CLIP-seq
MIRT2328861	hsa-miR-144	CLIP-seq
MIRT2328862	hsa-miR-148a	CLIP-seq
MIRT2328863	hsa-miR-148b	CLIP-seq
MIRT2328864	hsa-miR-152	CLIP-seq
MIRT2328865	hsa-miR-18a	CLIP-seq
MIRT2328866	hsa-miR-18b	CLIP-seq
MIRT1352746	hsa-miR-200a	CLIP-seq
MIRT2328867	hsa-miR-2117	CLIP-seq
MIRT2328868	hsa-miR-223	CLIP-seq
MIRT1352748	hsa-miR-23a	CLIP-seq
MIRT1352749	hsa-miR-23b	CLIP-seq
MIRT1352750	hsa-miR-23c	CLIP-seq
MIRT1352752	hsa-miR-3118	CLIP-seq
MIRT1352753	hsa-miR-3164	CLIP-seq
MIRT2328869	hsa-miR-345	CLIP-seq
MIRT2328870	hsa-miR-3611	CLIP-seq
MIRT2328871	hsa-miR-3714	CLIP-seq
MIRT2328872	hsa-miR-3910	CLIP-seq
MIRT2328873	hsa-miR-4264	CLIP-seq
MIRT2328874	hsa-miR-4273	CLIP-seq
MIRT1352757	hsa-miR-4275	CLIP-seq
MIRT2328875	hsa-miR-4276	CLIP-seq
MIRT2328876	hsa-miR-431	CLIP-seq
MIRT2328877	hsa-miR-4323	CLIP-seq
MIRT2328878	hsa-miR-4434	CLIP-seq
MIRT1352760	hsa-miR-4501	CLIP-seq
MIRT2328879	hsa-miR-4516	CLIP-seq
MIRT2328880	hsa-miR-4645-5p	CLIP-seq
MIRT2328881	hsa-miR-4673	CLIP-seq
MIRT2328882	hsa-miR-4735-3p	CLIP-seq
MIRT2328883	hsa-miR-4742-5p	CLIP-seq
MIRT2328884	hsa-miR-4755-3p	CLIP-seq
MIRT2328885	hsa-miR-4768-3p	CLIP-seq
MIRT1352763	hsa-miR-4775	CLIP-seq
MIRT2328886	hsa-miR-4797-3p	CLIP-seq
MIRT2328887	hsa-miR-495	CLIP-seq
MIRT2328888	hsa-miR-506	CLIP-seq
MIRT2328889	hsa-miR-548l	CLIP-seq
MIRT1352775	hsa-miR-548n	CLIP-seq
MIRT1352779	hsa-miR-582-5p	CLIP-seq
MIRT1352780	hsa-miR-590-3p	CLIP-seq
MIRT2328890	hsa-miR-665	CLIP-seq
MIRT2328891	hsa-miR-802	CLIP-seq
MIRT2328892	hsa-miR-935	CLIP-seq
MIRT1352783	hsa-miR-944	CLIP-seq
MIRT2623257	hsa-miR-1184	CLIP-seq
MIRT2623258	hsa-miR-1205	CLIP-seq
MIRT2328859	hsa-miR-124	CLIP-seq
MIRT2104465	hsa-miR-1261	CLIP-seq
MIRT2623259	hsa-miR-1301	CLIP-seq
MIRT1352751	hsa-miR-299-5p	CLIP-seq
MIRT2104466	hsa-miR-3121-5p	CLIP-seq
MIRT2623260	hsa-miR-3158-5p	CLIP-seq
MIRT2623261	hsa-miR-3653	CLIP-seq
MIRT2623262	hsa-miR-3658	CLIP-seq
MIRT2623263	hsa-miR-3683	CLIP-seq
MIRT2328871	hsa-miR-3714	CLIP-seq
MIRT2328872	hsa-miR-3910	CLIP-seq
MIRT1352755	hsa-miR-409-3p	CLIP-seq
MIRT2623264	hsa-miR-4279	CLIP-seq
MIRT2623265	hsa-miR-4312	CLIP-seq
MIRT2104467	hsa-miR-4448	CLIP-seq
MIRT2623266	hsa-miR-4522	CLIP-seq
MIRT2623267	hsa-miR-4660	CLIP-seq
MIRT2328884	hsa-miR-4755-3p	CLIP-seq
MIRT2328885	hsa-miR-4768-3p	CLIP-seq
MIRT2623268	hsa-miR-491-3p	CLIP-seq
MIRT2623269	hsa-miR-5047	CLIP-seq
MIRT2328888	hsa-miR-506	CLIP-seq
MIRT2623270	hsa-miR-532-5p	CLIP-seq
MIRT1352766	hsa-miR-548a-5p	CLIP-seq
MIRT1352767	hsa-miR-548ab	CLIP-seq
MIRT1352768	hsa-miR-548ak	CLIP-seq
MIRT1352769	hsa-miR-548b-5p	CLIP-seq
MIRT1352770	hsa-miR-548c-5p	CLIP-seq
MIRT1352771	hsa-miR-548d-5p	CLIP-seq
MIRT1352772	hsa-miR-548h	CLIP-seq
MIRT1352773	hsa-miR-548i	CLIP-seq
MIRT1352774	hsa-miR-548j	CLIP-seq
MIRT1352775	hsa-miR-548n	CLIP-seq
MIRT1352776	hsa-miR-548w	CLIP-seq
MIRT1352777	hsa-miR-548y	CLIP-seq
MIRT1352778	hsa-miR-559	CLIP-seq
MIRT2623271	hsa-miR-586	CLIP-seq
MIRT2328890	hsa-miR-665	CLIP-seq
MIRT2690881	hsa-miR-142-5p	CLIP-seq
MIRT2690882	hsa-miR-369-3p	CLIP-seq
MIRT2690883	hsa-miR-374a	CLIP-seq
MIRT2690884	hsa-miR-374b	CLIP-seq
MIRT2690885	hsa-miR-4633-5p	CLIP-seq
MIRT2690886	hsa-miR-561	CLIP-seq

Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005290	Function	L-histidine transmembrane transporter activity	IBA
GO:0005290	Function	L-histidine transmembrane transporter activity	IDA	25238095, 29224352
GO:0005290	Function	L-histidine transmembrane transporter activity	IEA
GO:0005515	Function	Protein binding	IPI	24695226, 28514442, 32433612, 33961781, 35271311
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	25238095, 29224352
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006857	Process	Oligopeptide transport	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0015031	Process	Protein transport	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015333	Function	Peptide:proton symporter activity	IDA	25238095, 29224352
GO:0015333	Function	Peptide:proton symporter activity	IEA
GO:0015333	Function	Peptide:proton symporter activity	TAS
GO:0015647	Function	Peptidoglycan transmembrane transporter activity	IDA	25238095, 29224352
GO:0015817	Process	Histidine transport	IBA
GO:0015833	Process	Peptide transport	IEA
GO:0015835	Process	Peptidoglycan transport	IDA	25238095, 29224352
GO:0015835	Process	Peptidoglycan transport	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0033023	Process	Mast cell homeostasis	IEA
GO:0033023	Process	Mast cell homeostasis	ISS
GO:0034157	Process	Positive regulation of toll-like receptor 7 signaling pathway	IEA
GO:0034157	Process	Positive regulation of toll-like receptor 7 signaling pathway	IMP	25238095, 32433612
GO:0034161	Process	Positive regulation of toll-like receptor 8 signaling pathway	IMP	32433612
GO:0034165	Process	Positive regulation of toll-like receptor 9 signaling pathway	IEA
GO:0034165	Process	Positive regulation of toll-like receptor 9 signaling pathway	IMP	25238095
GO:0035579	Component	Specific granule membrane	TAS
GO:0036020	Component	Endolysosome membrane	IDA	32433612
GO:0036020	Component	Endolysosome membrane	TAS
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IDA	32433612
GO:0048302	Process	Regulation of isotype switching to IgG isotypes	IEA
GO:0048302	Process	Regulation of isotype switching to IgG isotypes	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0070424	Process	Regulation of nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	IEA
GO:0070424	Process	Regulation of nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	ISS
GO:0070430	Process	Positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0070430	Process	Positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway	ISS
GO:0070434	Process	Positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA
GO:0070434	Process	Positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway	ISS
GO:0071916	Function	Dipeptide transmembrane transporter activity	IBA
GO:0071916	Function	Dipeptide transmembrane transporter activity	IDA	29224352, 31073693
GO:0089708	Process	L-histidine transmembrane export from vacuole	IEA
GO:0140206	Process	Dipeptide import across plasma membrane	IBA
GO:0140206	Process	Dipeptide import across plasma membrane	IDA	29224352, 31073693
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
615806	23090	ENSG00000139370

Q8N697

Protein name

Solute carrier family 15 member 4 (Peptide transporter 4) (Peptide/histidine transporter 1) (hPHT1)

Protein function

Proton-coupled amino-acid transporter that mediates the transmembrane transport of L-histidine and some di- and tripeptides from inside the lysosome to the cytosol, and plays a key role in innate immune response (PubMed:16289537, PubMed:25238095

PDB

8JZR , 8JZS , 8JZU , 8JZX , 8P6A , 8QSK , 8QSL , 8QSM , 8QSN , 8WX3 , 8WX4 , 8WX5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00854	PTR2	103 → 518	POT family	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in skeletal muscle. Moderately expressed in kidney, liver, and heart. Weakly expressed in colon and brain. Expressed in low levels throughout the gastrointestinal tract and in Caco-2 cells. Expressed in retinal fragmen

Sequence

MEGSGGGAGERAPLLGARRAAAAAAAAGAFAGRRAACGAVLLTELLERAAFYGITSNLVL
FLNGAPFCWEGAQASEALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGMLAF
PLLAAPATRAALCGSARLLNCTAPGPDAAARCCSPATFAGLVLVGLGVATVKANITPFGA
DQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFVTGYAIPTVCVGLAFVVF
LCGQSVFITKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCK
MSHGGPFTEEKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLRIPEISNITTT
PHTLPAAWLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAG
ILESKRLNLVKEKTINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAA
PKSMQSAIMGLFFFFSGVGSFVGSGLLALVSIKAIGWMSSHTDFGNINGCYLNYYFFLLA
AIQGATLLLFLIISVKYDHHRDHQRSRANGVPTSRRA

Sequence length

577

Interactions

View interactions

	Reactome
			Proton/oligopeptide cotransporters Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colitis Ulcerative	Ulcerative colitis	Pubtator	37445676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35562597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined Pituitary Hormone Deficiency	Combined pituitary hormone deficiency	Pubtator	29261175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19570976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19570976	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	19838193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27362648, 31001245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	19838193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	19838193, 23273568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	19838193, 23273568, 26502338, 28714469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20516000, 23249952, 24091983, 27362648		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	31073693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	20516000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panhypopituitarism	Panhypopituitarism	BEFREE	29261175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11742494, 22950754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	30262916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31001245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	20516000		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC15A4 (solute carrier family 15 member 4)