Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	121227
Gene name	Leucine rich repeats and immunoglobulin like domains 3
Gene symbol	LRIG3
Synonyms (NCBI Gene)	LIG3
Chromosome	12
Chromosome location	12q14.1

248

Show/Hide all (248)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016034	hsa-miR-374b-5p	Sequencing	20371350
MIRT031125	hsa-miR-19b-3p	Sequencing	20371350
MIRT051405	hsa-let-7f-5p	CLASH	23622248
MIRT050669	hsa-miR-18a-5p	CLASH	23622248
MIRT048604	hsa-miR-99a-5p	CLASH	23622248
MIRT046227	hsa-miR-27b-3p	CLASH	23622248
MIRT038852	hsa-miR-93-3p	CLASH	23622248
MIRT547581	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT547580	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT547579	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT547578	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT547577	hsa-miR-4500	PAR-CLIP	20371350
MIRT547576	hsa-miR-4458	PAR-CLIP	20371350
MIRT547575	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT547574	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT051405	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT547573	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT547572	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT547571	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT547570	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT547569	hsa-miR-100-3p	PAR-CLIP	20371350
MIRT547568	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT547567	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT547565	hsa-miR-3614-5p	PAR-CLIP	20371350
MIRT547566	hsa-miR-6500-3p	PAR-CLIP	20371350
MIRT547564	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT547563	hsa-miR-567	PAR-CLIP	20371350
MIRT547562	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT066257	hsa-miR-4282	PAR-CLIP	20371350
MIRT188029	hsa-miR-3163	PAR-CLIP	20371350
MIRT547560	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT547559	hsa-miR-556-5p	PAR-CLIP	20371350
MIRT547558	hsa-miR-630	PAR-CLIP	20371350
MIRT547557	hsa-miR-7977	PAR-CLIP	20371350
MIRT547556	hsa-miR-335-3p	PAR-CLIP	20371350
MIRT547581	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT547580	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT547579	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT547578	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT547577	hsa-miR-4500	PAR-CLIP	20371350
MIRT547576	hsa-miR-4458	PAR-CLIP	20371350
MIRT547575	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT547574	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT051405	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT547573	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT547572	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT547571	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT547570	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT547569	hsa-miR-100-3p	PAR-CLIP	20371350
MIRT547568	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT547567	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT547565	hsa-miR-3614-5p	PAR-CLIP	20371350
MIRT547566	hsa-miR-6500-3p	PAR-CLIP	20371350
MIRT547564	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT547563	hsa-miR-567	PAR-CLIP	20371350
MIRT066257	hsa-miR-4282	PAR-CLIP	20371350
MIRT547560	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT547559	hsa-miR-556-5p	PAR-CLIP	20371350
MIRT547557	hsa-miR-7977	PAR-CLIP	20371350
MIRT547556	hsa-miR-335-3p	PAR-CLIP	20371350
MIRT547581	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547580	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547579	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT547578	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT547577	hsa-miR-4500	PAR-CLIP	21572407
MIRT547576	hsa-miR-4458	PAR-CLIP	21572407
MIRT547575	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT547574	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT051405	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT547573	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT547572	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT547571	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT547570	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT547569	hsa-miR-100-3p	PAR-CLIP	21572407
MIRT547568	hsa-miR-208a-5p	PAR-CLIP	21572407
MIRT547567	hsa-miR-208b-5p	PAR-CLIP	21572407
MIRT547565	hsa-miR-3614-5p	PAR-CLIP	21572407
MIRT547566	hsa-miR-6500-3p	PAR-CLIP	21572407
MIRT547564	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT547563	hsa-miR-567	PAR-CLIP	21572407
MIRT547562	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT066257	hsa-miR-4282	PAR-CLIP	21572407
MIRT547561	hsa-miR-4678	PAR-CLIP	21572407
MIRT188029	hsa-miR-3163	PAR-CLIP	21572407
MIRT547560	hsa-miR-382-3p	PAR-CLIP	21572407
MIRT547559	hsa-miR-556-5p	PAR-CLIP	21572407
MIRT547558	hsa-miR-630	PAR-CLIP	21572407
MIRT547557	hsa-miR-7977	PAR-CLIP	21572407
MIRT547556	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT536239	hsa-miR-944	PAR-CLIP	22012620
MIRT536238	hsa-miR-4760-3p	PAR-CLIP	22012620
MIRT536237	hsa-miR-4272	PAR-CLIP	22012620
MIRT536236	hsa-miR-8060	PAR-CLIP	22012620
MIRT536235	hsa-miR-3185	PAR-CLIP	22012620
MIRT536234	hsa-miR-7154-5p	PAR-CLIP	22012620
MIRT536233	hsa-miR-433-3p	PAR-CLIP	22012620
MIRT536232	hsa-miR-516b-5p	PAR-CLIP	22012620
MIRT547581	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT547580	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT547579	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT547578	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT547577	hsa-miR-4500	PAR-CLIP	20371350
MIRT547576	hsa-miR-4458	PAR-CLIP	20371350
MIRT547575	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT547574	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT051405	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT547573	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT547572	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT547571	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT547570	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT547569	hsa-miR-100-3p	PAR-CLIP	20371350
MIRT547568	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT547567	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT547565	hsa-miR-3614-5p	PAR-CLIP	20371350
MIRT547566	hsa-miR-6500-3p	PAR-CLIP	20371350
MIRT547564	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT547563	hsa-miR-567	PAR-CLIP	20371350
MIRT547562	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT066257	hsa-miR-4282	PAR-CLIP	20371350
MIRT188029	hsa-miR-3163	PAR-CLIP	20371350
MIRT547560	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT547559	hsa-miR-556-5p	PAR-CLIP	20371350
MIRT547558	hsa-miR-630	PAR-CLIP	20371350
MIRT547557	hsa-miR-7977	PAR-CLIP	20371350
MIRT547556	hsa-miR-335-3p	PAR-CLIP	20371350
MIRT547581	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT547580	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT547579	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT547578	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT547577	hsa-miR-4500	PAR-CLIP	20371350
MIRT547576	hsa-miR-4458	PAR-CLIP	20371350
MIRT547575	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT547574	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT051405	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT547573	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT547572	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT547571	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT547570	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT547569	hsa-miR-100-3p	PAR-CLIP	20371350
MIRT547568	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT547567	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT547565	hsa-miR-3614-5p	PAR-CLIP	20371350
MIRT547566	hsa-miR-6500-3p	PAR-CLIP	20371350
MIRT547564	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT547563	hsa-miR-567	PAR-CLIP	20371350
MIRT066257	hsa-miR-4282	PAR-CLIP	20371350
MIRT547560	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT547559	hsa-miR-556-5p	PAR-CLIP	20371350
MIRT547557	hsa-miR-7977	PAR-CLIP	20371350
MIRT547556	hsa-miR-335-3p	PAR-CLIP	20371350
MIRT547581	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547580	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547579	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT547578	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT547577	hsa-miR-4500	PAR-CLIP	21572407
MIRT547576	hsa-miR-4458	PAR-CLIP	21572407
MIRT547575	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT547574	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT051405	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT547573	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT547572	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT547571	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT547570	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT547569	hsa-miR-100-3p	PAR-CLIP	21572407
MIRT547568	hsa-miR-208a-5p	PAR-CLIP	21572407
MIRT547567	hsa-miR-208b-5p	PAR-CLIP	21572407
MIRT547565	hsa-miR-3614-5p	PAR-CLIP	21572407
MIRT547566	hsa-miR-6500-3p	PAR-CLIP	21572407
MIRT547564	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT547563	hsa-miR-567	PAR-CLIP	21572407
MIRT547562	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT066257	hsa-miR-4282	PAR-CLIP	21572407
MIRT547561	hsa-miR-4678	PAR-CLIP	21572407
MIRT188029	hsa-miR-3163	PAR-CLIP	21572407
MIRT547560	hsa-miR-382-3p	PAR-CLIP	21572407
MIRT547559	hsa-miR-556-5p	PAR-CLIP	21572407
MIRT547558	hsa-miR-630	PAR-CLIP	21572407
MIRT547557	hsa-miR-7977	PAR-CLIP	21572407
MIRT547556	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT536239	hsa-miR-944	PAR-CLIP	22012620
MIRT536238	hsa-miR-4760-3p	PAR-CLIP	22012620
MIRT536237	hsa-miR-4272	PAR-CLIP	22012620
MIRT536236	hsa-miR-8060	PAR-CLIP	22012620
MIRT536235	hsa-miR-3185	PAR-CLIP	22012620
MIRT536234	hsa-miR-7154-5p	PAR-CLIP	22012620
MIRT536233	hsa-miR-433-3p	PAR-CLIP	22012620
MIRT536232	hsa-miR-516b-5p	PAR-CLIP	22012620
MIRT1117705	hsa-let-7a	CLIP-seq
MIRT1117706	hsa-let-7b	CLIP-seq
MIRT1117707	hsa-let-7c	CLIP-seq
MIRT1117708	hsa-let-7d	CLIP-seq
MIRT1117709	hsa-let-7e	CLIP-seq
MIRT1117710	hsa-let-7f	CLIP-seq
MIRT1117711	hsa-let-7g	CLIP-seq
MIRT1117712	hsa-let-7i	CLIP-seq
MIRT1117713	hsa-miR-196a	CLIP-seq
MIRT1117714	hsa-miR-196b	CLIP-seq
MIRT1117715	hsa-miR-202	CLIP-seq
MIRT1117716	hsa-miR-2054	CLIP-seq
MIRT1117717	hsa-miR-4775	CLIP-seq
MIRT1117718	hsa-miR-548n	CLIP-seq
MIRT1117719	hsa-miR-548t	CLIP-seq
MIRT1117720	hsa-miR-590-3p	CLIP-seq
MIRT1117721	hsa-miR-659	CLIP-seq
MIRT1117722	hsa-miR-98	CLIP-seq
MIRT1117723	hsa-miR-129-5p	CLIP-seq
MIRT1117724	hsa-miR-153	CLIP-seq
MIRT1117725	hsa-miR-448	CLIP-seq
MIRT1117726	hsa-miR-450b-5p	CLIP-seq
MIRT1117727	hsa-miR-4662a-3p	CLIP-seq
MIRT1117728	hsa-miR-507	CLIP-seq
MIRT1117729	hsa-miR-557	CLIP-seq
MIRT1117705	hsa-let-7a	CLIP-seq
MIRT1117706	hsa-let-7b	CLIP-seq
MIRT1117707	hsa-let-7c	CLIP-seq
MIRT1117708	hsa-let-7d	CLIP-seq
MIRT1117709	hsa-let-7e	CLIP-seq
MIRT1117710	hsa-let-7f	CLIP-seq
MIRT1117711	hsa-let-7g	CLIP-seq
MIRT1117712	hsa-let-7i	CLIP-seq
MIRT1550904	hsa-miR-133a	CLIP-seq
MIRT1550905	hsa-miR-133b	CLIP-seq
MIRT1117713	hsa-miR-196a	CLIP-seq
MIRT1117714	hsa-miR-196b	CLIP-seq
MIRT1117715	hsa-miR-202	CLIP-seq
MIRT1550906	hsa-miR-3121-5p	CLIP-seq
MIRT1117718	hsa-miR-548n	CLIP-seq
MIRT1117719	hsa-miR-548t	CLIP-seq
MIRT1550907	hsa-miR-9	CLIP-seq
MIRT1117722	hsa-miR-98	CLIP-seq
MIRT1117705	hsa-let-7a	CLIP-seq
MIRT1117706	hsa-let-7b	CLIP-seq
MIRT1117707	hsa-let-7c	CLIP-seq
MIRT1117708	hsa-let-7d	CLIP-seq
MIRT1117709	hsa-let-7e	CLIP-seq
MIRT1117710	hsa-let-7f	CLIP-seq
MIRT1117711	hsa-let-7g	CLIP-seq
MIRT1117712	hsa-let-7i	CLIP-seq
MIRT1550904	hsa-miR-133a	CLIP-seq
MIRT1550905	hsa-miR-133b	CLIP-seq
MIRT1117713	hsa-miR-196a	CLIP-seq
MIRT1117714	hsa-miR-196b	CLIP-seq
MIRT1117715	hsa-miR-202	CLIP-seq
MIRT1550906	hsa-miR-3121-5p	CLIP-seq
MIRT1117718	hsa-miR-548n	CLIP-seq
MIRT1117719	hsa-miR-548t	CLIP-seq
MIRT1550907	hsa-miR-9	CLIP-seq
MIRT1117722	hsa-miR-98	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	23723069, 30429017, 33961781
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007605	Process	Sensory perception of sound	IBA
GO:0016020	Component	Membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032474	Process	Otolith morphogenesis	IEA
GO:0038023	Function	Signaling receptor activity	IBA

MIM	HGNC	e!Ensembl
608870	30991	ENSG00000139263

Q6UXM1

Protein name

Leucine-rich repeats and immunoglobulin-like domains protein 3 (LIG-3)

Protein function

May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	121 → 179	Leucine rich repeat	Repeat
PF13855	LRR_8	167 → 227	Leucine rich repeat	Repeat
PF13855	LRR_8	215 → 275	Leucine rich repeat	Repeat
PF13855	LRR_8	263 → 323	Leucine rich repeat	Repeat
PF13855	LRR_8	311 → 371	Leucine rich repeat	Repeat
PF13855	LRR_8	375 → 446	Leucine rich repeat	Repeat
PF13927	Ig_3	498 → 585		Domain
PF07679	I-set	603 → 693	Immunoglobulin I-set domain	Domain
PF07679	I-set	697 → 784	Immunoglobulin I-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:15203213}.

Sequence

MSAPSLRARAAGLGLLLCAVLGRAGRSDSGGRGELGQPSGVAAERPCPTTCRCLGDLLDC
SRKRLARLPEPLPSWVARLDLSHNRLSFIKASSMSHLQSLREVKLNNNELETIPNLGPVS
ANITLLSLAGNRIVEILPEHLKEFQSLETLDLSSNNISELQTAFPALQLKYLYLNSNRVT
SMEPGYFDNLANTLLVLKLNRNRISAIPPKMFKLPQLQHLELNRNKIKNVDGLTFQGLGA
LKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAIN
RISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSS
LKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDN
AIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQSFVNASCAHPQLLKG
RSIFAVSPDGFVCDDFPKPQITVQPETQSAIKGSNLSFICSAASSSDSPMTFAWKKDNEL
LHDAEMENYAHLRAQGGEVMEYTTILRLREVEFASEGKYQCVISNHFGSSYSVKAKLTVN
MLPSFTKTPMDLTIRAGAMARLECAAVGHPAPQIAWQKDGGTDFPAARERRMHVMPEDDV
FFIVDVKIEDIGVYSCTAQNSAGSISANATLTVLETPSFLRPLLDRTVTKGETAVLQCIA
GGSPPPKLNWTKDDSPLVVTERHFFAAGNQLLIIVDSDVSDAGKYTCEMSNTLGTERGNV
RLSVIPTPTCDSPQMTAPSLDDDGWATVGVVIIAVVCCVVGTSLVWVVIIYHTRRRNEDC
SITNTDETNLPADIPSYLSSQGTLADRQDGYVSSESGSHHQFVTSSGAGFFLPQHDSSGT
CHIDNSSEADVEAATDLFLCPFLGSTGPMYLKGNVYGSDPFETYHTGCSPDPRTVLMDHY
EPSYIKKKECYPCSHPSEESCERSFSNISWPSHVRKLLNTSYSHNEGPGMKNLCLNKSSL
DFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSG
SEEDGKERTDFQEENHICTFKQTLENYRTPNFQSYDLDT

Sequence length

1119

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (70)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma of large intestine	Colorectal adenoma	BEFREE	23951112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29474873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anencephaly	Anencephaly	Pubtator	30022792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	24342190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17203305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	8265359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16492928, 28940489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40493574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30310528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17203305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28334093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	26517670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15596292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26649135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26649135, 32312920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32107843	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27866211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19147782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	LHGDN	19216216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	37511066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	25817347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	30022792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19200647, 20446891, 31245283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19200647, 20446891, 31245283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19200647, 20446891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19448407, 36639372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31119777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	37511066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	25817347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	30022792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25828893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	40493574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29633598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30022792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16492928, 28940489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19147782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30412760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31034940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17203305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19200647, 23558895, 31034940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27866211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	22905093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	29632340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29632340, 30120376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	30120376, 32079692	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	31748924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	25828893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	40493574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16532360, 19200647, 29246624, 31245283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	36988399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	30022792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	30022792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25563294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25563294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30664745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36988399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19147782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19147782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	17393120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	31748924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	31748924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30412760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15205355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31034940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	31748924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19913990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neurogenic	Neurogenic bladder	Pubtator	39173721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	24998916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Visceral myopathy familial external ophthalmoplegia	Visceral neuropathy	Pubtator	30310528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LRIG3 (leucine rich repeats and immunoglobulin like domains 3)