Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1211
Gene name	Clathrin light chain A
Gene symbol	CLTA
Synonyms (NCBI Gene)	LCA
Chromosome	9
Chromosome location	9p13.3
Summary	Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytos

116

Show/Hide all (116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020728	hsa-miR-155-5p	Proteomics	18668040
MIRT022724	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT029517	hsa-miR-26b-5p	Microarray	19088304
MIRT046362	hsa-miR-23b-3p	CLASH	23622248
MIRT107700	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT107700	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT107707	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT107701	hsa-miR-3159	PAR-CLIP	21572407
MIRT107702	hsa-miR-4255	PAR-CLIP	21572407
MIRT107712	hsa-miR-7852-3p	PAR-CLIP	21572407
MIRT558700	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT558699	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT558698	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT558697	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT558696	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT558695	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT558694	hsa-miR-6837-3p	PAR-CLIP	21572407
MIRT107709	hsa-miR-6073	PAR-CLIP	21572407
MIRT558693	hsa-miR-181b-2-3p	PAR-CLIP	21572407
MIRT558692	hsa-miR-181b-3p	PAR-CLIP	21572407
MIRT558691	hsa-miR-4420	PAR-CLIP	21572407
MIRT558690	hsa-miR-653-3p	PAR-CLIP	21572407
MIRT107710	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT107711	hsa-miR-1273h-3p	PAR-CLIP	21572407
MIRT107705	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT558689	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT107700	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT107700	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT107707	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT107701	hsa-miR-3159	PAR-CLIP	21572407
MIRT107702	hsa-miR-4255	PAR-CLIP	21572407
MIRT107712	hsa-miR-7852-3p	PAR-CLIP	21572407
MIRT558700	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT558699	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT558698	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT558697	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT558696	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT558695	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT558694	hsa-miR-6837-3p	PAR-CLIP	21572407
MIRT107709	hsa-miR-6073	PAR-CLIP	21572407
MIRT558693	hsa-miR-181b-2-3p	PAR-CLIP	21572407
MIRT558692	hsa-miR-181b-3p	PAR-CLIP	21572407
MIRT558691	hsa-miR-4420	PAR-CLIP	21572407
MIRT558690	hsa-miR-653-3p	PAR-CLIP	21572407
MIRT107710	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT107711	hsa-miR-1273h-3p	PAR-CLIP	21572407
MIRT107705	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT558689	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT898025	hsa-miR-1236	CLIP-seq
MIRT898026	hsa-miR-1304	CLIP-seq
MIRT898027	hsa-miR-1470	CLIP-seq
MIRT898028	hsa-miR-2467-5p	CLIP-seq
MIRT898029	hsa-miR-3127-3p	CLIP-seq
MIRT898030	hsa-miR-3183	CLIP-seq
MIRT898031	hsa-miR-3188	CLIP-seq
MIRT898032	hsa-miR-3667-3p	CLIP-seq
MIRT898033	hsa-miR-3975	CLIP-seq
MIRT898034	hsa-miR-4287	CLIP-seq
MIRT898035	hsa-miR-4330	CLIP-seq
MIRT898036	hsa-miR-4469	CLIP-seq
MIRT898037	hsa-miR-4667-3p	CLIP-seq
MIRT898038	hsa-miR-4685-3p	CLIP-seq
MIRT898039	hsa-miR-4691-5p	CLIP-seq
MIRT898040	hsa-miR-4723-3p	CLIP-seq
MIRT898041	hsa-miR-4747-5p	CLIP-seq
MIRT898042	hsa-miR-485-5p	CLIP-seq
MIRT898043	hsa-miR-635	CLIP-seq
MIRT898044	hsa-miR-642a	CLIP-seq
MIRT898045	hsa-miR-133a	CLIP-seq
MIRT898046	hsa-miR-133b	CLIP-seq
MIRT898035	hsa-miR-4330	CLIP-seq
MIRT898047	hsa-miR-4464	CLIP-seq
MIRT898048	hsa-miR-4509	CLIP-seq
MIRT898049	hsa-miR-4744	CLIP-seq
MIRT898050	hsa-miR-4748	CLIP-seq
MIRT898051	hsa-miR-548u	CLIP-seq
MIRT898052	hsa-miR-618	CLIP-seq
MIRT1556184	hsa-miR-1252	CLIP-seq
MIRT898026	hsa-miR-1304	CLIP-seq
MIRT898027	hsa-miR-1470	CLIP-seq
MIRT898028	hsa-miR-2467-5p	CLIP-seq
MIRT2202147	hsa-miR-25	CLIP-seq
MIRT898029	hsa-miR-3127-3p	CLIP-seq
MIRT898031	hsa-miR-3188	CLIP-seq
MIRT2202148	hsa-miR-32	CLIP-seq
MIRT2202149	hsa-miR-3611	CLIP-seq
MIRT2202150	hsa-miR-363	CLIP-seq
MIRT2202151	hsa-miR-367	CLIP-seq
MIRT898033	hsa-miR-3975	CLIP-seq
MIRT898035	hsa-miR-4330	CLIP-seq
MIRT898037	hsa-miR-4667-3p	CLIP-seq
MIRT2202152	hsa-miR-4709-3p	CLIP-seq
MIRT898041	hsa-miR-4747-5p	CLIP-seq
MIRT898042	hsa-miR-485-5p	CLIP-seq
MIRT898043	hsa-miR-635	CLIP-seq
MIRT898044	hsa-miR-642a	CLIP-seq
MIRT2202153	hsa-miR-92a	CLIP-seq
MIRT2202154	hsa-miR-92b	CLIP-seq
MIRT2202155	hsa-miR-943	CLIP-seq
MIRT1556184	hsa-miR-1252	CLIP-seq
MIRT1556184	hsa-miR-1252	CLIP-seq
MIRT2447226	hsa-miR-4270	CLIP-seq
MIRT2447227	hsa-miR-4427	CLIP-seq
MIRT2447228	hsa-miR-4441	CLIP-seq
MIRT2447229	hsa-miR-4680-3p	CLIP-seq
MIRT2447230	hsa-miR-4755-3p	CLIP-seq
MIRT1556184	hsa-miR-1252	CLIP-seq
MIRT898026	hsa-miR-1304	CLIP-seq
MIRT898028	hsa-miR-2467-5p	CLIP-seq
MIRT898031	hsa-miR-3188	CLIP-seq
MIRT898033	hsa-miR-3975	CLIP-seq
MIRT898035	hsa-miR-4330	CLIP-seq
MIRT898041	hsa-miR-4747-5p	CLIP-seq
MIRT898042	hsa-miR-485-5p	CLIP-seq
MIRT2678333	hsa-miR-494	CLIP-seq
MIRT898043	hsa-miR-635	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	16595675, 21297582, 30021884, 32814053, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IDA
GO:0005768	Component	Endosome	IDA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030118	Component	Clathrin coat	IEA
GO:0030118	Component	Clathrin coat	IMP	11756460
GO:0030118	Component	Clathrin coat	NAS	3267234
GO:0030125	Component	Clathrin vesicle coat	IBA
GO:0030130	Component	Clathrin coat of trans-Golgi network vesicle	IEA
GO:0030132	Component	Clathrin coat of coated pit	IEA
GO:0030136	Component	Clathrin-coated vesicle	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	ISS
GO:0032050	Function	Clathrin heavy chain binding	IBA
GO:0032050	Function	Clathrin heavy chain binding	IPI	4066749
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0036020	Component	Endolysosome membrane	TAS
GO:0042277	Function	Peptide binding	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045334	Component	Clathrin-coated endocytic vesicle	NAS	25898166
GO:0048268	Process	Clathrin coat assembly	IMP	11756460
GO:0048488	Process	Synaptic vesicle endocytosis	IEA
GO:0051020	Function	GTPase binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0071439	Component	Clathrin complex	IDA	4066749
GO:0072583	Process	Clathrin-dependent endocytosis	IBA
GO:0098835	Component	Presynaptic endocytic zone membrane	IEA
GO:0098843	Component	Postsynaptic endocytic zone	IEA

MIM	HGNC	e!Ensembl
118960	2090	ENSG00000122705

P09496

Protein name

Clathrin light chain A (Lca)

Protein function

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as a component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-mi

PDB

6E5N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01086	Clathrin_lg_ch	15 → 247	Clathrin light chain	Family

Sequence

MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV
TNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
LKQAPLVH

Sequence length

248

Interactions

View interactions

	KEGG		Reactome
	Lysosome Endocytosis Synaptic vesicle cycle Endocrine and other factor-regulated calcium reabsorption Huntington disease Bacterial invasion of epithelial cells		Entry of Influenza Virion into Host Cell via Endocytosis Retrograde neurotrophin signalling Gap junction degradation Formation of annular gap junctions MHC class II antigen presentation EPH-ephrin mediated repulsion of cells Lysosome Vesicle Biogenesis Golgi Associated Vesicle Biogenesis Recycling pathway of L1 WNT5A-dependent internalization of FZD4 WNT5A-dependent internalization of FZD2, FZD5 and ROR2 Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis VLDLR internalisation and degradation LDL clearance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATYPICAL FEMORAL FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALIZED ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (50)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	11528500, 18055821, 18632300, 18936139, 20079931, 20104588, 22261762, 23308101, 23661368, 24066033, 27010695, 27422788, 31693188, 8750633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29378976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35273614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29454227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29454227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29655782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	40214395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	25660334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Extraskeletal myxoid chondrosarcoma	Pubtator	24293381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophies	Cone-rod dystrophy	BEFREE	28369829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28369829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	29476189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	35144391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	24293381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32596376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18474104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	23597029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	25380293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	2297052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	40214395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leber Congenital Amaurosis	Leber Congenital Amaurosis	BEFREE	16936081, 20079931, 31190471		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEBER CONGENITAL AMAUROSIS 9 (disorder)	Leber Congenital Amaurosis	BEFREE	28369829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23261408, 23289635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11706081, 31693188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29655782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30763573		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31567589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31567589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	28685876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19309551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	18361423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31787032, 9870150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12110339		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	CLINVAR_DG	11528398, 12177386, 12409274, 12473753, 12473769, 12497639, 12811782, 14707127, 14733963, 14972325, 15136692, 15146476, 15147877, 15330759, 15670773 View all (49 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29378976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	34208719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	26773759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	11521232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dysplasia	Retinal Dysplasia	BEFREE	22159006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dystrophy, Early Onset Severe	Retinal Dystrophy	BEFREE	31630094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	20079931, 24265693, 26267445, 26773759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15841095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	BEFREE	28369829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	24293381, 34352867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sialuria	Sialuria	CLINVAR_DG	11528398, 12409274, 12473753, 12473769, 12497639, 14707127, 15147877, 15670773, 15987957, 16503651, 16810679, 20059379, 20175955, 20300792, 21307865 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28337964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27895315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	31442209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31787032		★★★★★ ★☆☆☆☆ Found in Text Mining only

CLTA (clathrin light chain A)