JAML (junction adhesion molecule like)

Gene

• Entrez ID: 120425
• Gene name: Junction adhesion molecule like
• Gene symbol: JAML
• Synonyms (NCBI Gene): AMICA, AMICA1, CREA7-1, CREA7-4, Gm638
• Chromosome: 11
• Chromosome location: 11q23.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT572861	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT572860	hsa-miR-4328	PAR-CLIP	20371350
MIRT572859	hsa-miR-665	PAR-CLIP	20371350
MIRT572858	hsa-miR-3124-3p	PAR-CLIP	20371350
MIRT572857	hsa-miR-4691-5p	PAR-CLIP	20371350
MIRT572856	hsa-miR-6792-3p	PAR-CLIP	20371350
MIRT572855	hsa-miR-6749-3p	PAR-CLIP	20371350
MIRT572854	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT572853	hsa-miR-1238-3p	PAR-CLIP	20371350

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005178	Function	Integrin binding	IPI	12869515
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12869515
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005923	Component	Bicellular tight junction	IDA	15800062
GO:0007155	Process	Cell adhesion	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	12869515, 15800062
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	18948633
GO:0016020	Component	Membrane	IEA
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0030593	Process	Neutrophil chemotaxis	IMP	15800062
GO:0035696	Process	Monocyte extravasation	IBA
GO:0035696	Process	Monocyte extravasation	IMP	18948633
GO:0042803	Function	Protein homodimerization activity	IDA	12869515
GO:0046629	Process	Gamma-delta T cell activation	ISS
GO:0050839	Function	Cell adhesion molecule binding	IBA
GO:0050839	Function	Cell adhesion molecule binding	IPI	12869515, 15800062
GO:0060054	Process	Positive regulation of epithelial cell proliferation involved in wound healing	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0072672	Process	Neutrophil extravasation	IBA
GO:0072672	Process	Neutrophil extravasation	IMP	15800062

Other IDs

• MIM: 609770
• HGNC: 19084
• e!Ensembl: ENSG00000160593

Protein

• UniProt ID: Q86YT9
• Protein name: Junctional adhesion molecule-like (Adhesion molecule interacting with CXADR antigen 1) (Dendritic cell-specific protein CREA7-1)
• Protein function: Transmembrane protein of the plasma membrane of leukocytes that control their migration and activation through interaction with CXADR, a plasma membrane receptor found on adjacent epithelial and endothelial cells. The interaction between both re
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	25 → 136	Immunoglobulin V-set domain	Domain
  PF07686	V-set	138 → 252	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expression is restricted to the hematopoietic tissues with the exception of liver. Expressed in fetal liver, spleen and thymus. Preferentially expressed by mature leukocytes (at protein level). {ECO:0000269|PubMed:12869515, ECO:0000269
• Sequence:

  MFCPLKLILLPVLLDYSLGLNDLNVSPPELTVHVGDSALMGCVFQSTEDKCIFKIDWTLS
  PGEHAKDEYVLYYYSNLSVPIGRFQNRVHLMGDILCNDGSLLLQDVQEADQGTYICEIRL
  KGESQVFKKAVVLHVLPEEPKELMVHVGGLIQMGCVFQSTEVKHVTKVEWIFSGRRAKEE
  IVFRYYHKLRMSVEYSQSWGHFQNRVNLVGDIFRNDGSIMLQGVRESDGGNYTCSIHLGN
  LVFKKTIVLHVSPEEPRTLVTPAALRPLVLGGNQLVIIVGIVCATILLLPVLILIVKKTC
  GNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEAT
  YMTMHPVWPSLRSDRNNSLEKKSGGGMPKTQQAF

• Sequence length: 394

Pathways

KEGG:

Cell adhesion molecules

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Cell surface interactions at the vascular wall

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atrial Fibrillation	Atrial Fibrillation	BEFREE	31760819		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35672776	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18776587	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31760819		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18776587	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31760819		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	29914815		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	12869515	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	12869515	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39290707	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39290707	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35672776	Associate	★☆☆☆☆ Found in Text Mining only