Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	12
Gene name	Serpin family A member 3
Gene symbol	SERPINA3
Synonyms (NCBI Gene)	AACTACTGIG24GIG25
Chromosome	14
Chromosome location	14q32.13
Summary	The protein encoded by this gene is a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. This gene is one in a cluster of serpin genes located on the q arm of chromosome 14. Polymorphisms in this protein appear to

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs17473	C>G,T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs1800463	T>A,C	Pathogenic	Coding sequence variant, missense variant
rs116929575	A>G	Pathogenic, uncertain-significance	Missense variant, coding sequence variant

159

Show/Hide all (159)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016786	hsa-miR-335-5p	Microarray	18185580
MIRT437804	hsa-miR-137	Luciferase reporter assay	23640964
MIRT644600	hsa-miR-499b-5p	HITS-CLIP	23824327
MIRT618451	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT618449	hsa-miR-5590-5p	HITS-CLIP	23824327
MIRT618448	hsa-miR-4659a-5p	HITS-CLIP	23824327
MIRT618447	hsa-miR-4659b-5p	HITS-CLIP	23824327
MIRT618446	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT644599	hsa-miR-5096	HITS-CLIP	23824327
MIRT613734	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT613733	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT610047	hsa-miR-3183	HITS-CLIP	23824327
MIRT610046	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT610045	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT610044	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT610040	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT613732	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT613731	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT610047	hsa-miR-3183	HITS-CLIP	23824327
MIRT610046	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT610045	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT610044	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT613732	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT613731	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT613734	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT613733	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT618451	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT618450	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT618449	hsa-miR-5590-5p	HITS-CLIP	23824327
MIRT618448	hsa-miR-4659a-5p	HITS-CLIP	23824327
MIRT618447	hsa-miR-4659b-5p	HITS-CLIP	23824327
MIRT618446	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT613734	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT613733	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT610047	hsa-miR-3183	HITS-CLIP	23824327
MIRT610046	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT610045	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT610044	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT610040	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT613732	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT613731	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT613734	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT613733	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT610047	hsa-miR-3183	HITS-CLIP	23824327
MIRT610046	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT610045	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT610044	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT610040	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT613732	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT613731	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT613734	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT613733	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT613732	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT613731	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT610047	hsa-miR-3183	HITS-CLIP	23824327
MIRT610046	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT610045	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT610044	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT610040	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT618450	hsa-miR-197-3p	qRT-PCR	28418912
MIRT644600	hsa-miR-499b-5p	HITS-CLIP	23824327
MIRT618451	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT618449	hsa-miR-5590-5p	HITS-CLIP	23824327
MIRT618448	hsa-miR-4659a-5p	HITS-CLIP	23824327
MIRT618447	hsa-miR-4659b-5p	HITS-CLIP	23824327
MIRT618446	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT644599	hsa-miR-5096	HITS-CLIP	23824327
MIRT613734	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT613733	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT610047	hsa-miR-3183	HITS-CLIP	23824327
MIRT610046	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT610045	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT610044	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT610040	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT613732	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT613731	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT610047	hsa-miR-3183	HITS-CLIP	23824327
MIRT610046	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT610045	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT610044	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT613732	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT613731	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT613734	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT613733	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT618451	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT618450	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT618449	hsa-miR-5590-5p	HITS-CLIP	23824327
MIRT618448	hsa-miR-4659a-5p	HITS-CLIP	23824327
MIRT618447	hsa-miR-4659b-5p	HITS-CLIP	23824327
MIRT618446	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT613734	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT613733	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT610047	hsa-miR-3183	HITS-CLIP	23824327
MIRT610046	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT610045	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT610044	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT610040	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT613732	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT613731	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT613734	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT613733	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT610047	hsa-miR-3183	HITS-CLIP	23824327
MIRT610046	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT610045	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT610044	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT610040	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT613732	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT613731	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT613734	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT613733	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT613732	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT613731	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT610047	hsa-miR-3183	HITS-CLIP	23824327
MIRT610046	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT610045	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT610044	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT610043	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT610042	hsa-miR-3909	HITS-CLIP	23824327
MIRT610041	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT610040	hsa-miR-7111-3p	HITS-CLIP	23824327

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Repression	11027208
RELA	Repression	11027208

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	TAS	14668352
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	TAS	2404007
GO:0005515	Function	Protein binding	IPI	12709365, 14668352, 14687906, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	8647626, 9880565, 14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	25645918
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	TAS	14668352
GO:0006953	Process	Acute-phase response	IEA
GO:0006954	Process	Inflammatory response	NAS	12475184
GO:0019216	Process	Regulation of lipid metabolic process	NAS	11835318
GO:0030277	Process	Maintenance of gastrointestinal epithelium	NAS	8647626
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031012	Component	Extracellular matrix	HDA	28344315, 28675934
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0034097	Process	Response to cytokine	IBA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072562	Component	Blood microparticle	HDA	22516433

MIM	HGNC	e!Ensembl
107280	16	ENSG00000196136

P01011

Protein name

Alpha-1-antichymotrypsin (ACT) (Cell growth-inhibiting gene 24/25 protein) (Serpin A3) [Cleaved into: Alpha-1-antichymotrypsin His-Pro-less]

Protein function

Although its physiological function is unclear, it can inhibit neutrophil cathepsin G and mast cell chymase, both of which can convert angiotensin-1 to the active angiotensin-2.

PDB

1AS4 , 1QMN , 2ACH , 3CAA , 3DLW , 4CAA , 6HGE , 9C2T , 9D7K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00079	Serpin	51 → 420	Serpin (serine protease inhibitor)	Domain

Tissue specificity

TISSUE SPECIFICITY: Plasma. Synthesized in the liver. Like the related alpha-1-antitrypsin, its concentration increases in the acute phase of inflammation or infection. Found in the amyloid plaques from the hippocampus of Alzheimer disease brains. {ECO:00

Sequence

MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSL
YKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQ
HLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVM
VPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWR
DSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHK
AVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP
KQA

Sequence length

423

Interactions

View interactions

	Reactome
			Platelet degranulation Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
ANTICHYMOTRYPSIN BOCHUM 1	Pathogenic	rs1800463	RCV000019665	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTICHYMOTRYPSIN BONN 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antichymotrypsin deficiency-alpha-1	Likely benign	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ANTICHYMOTRYPSIN ISEHARA 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTICHYMOTRYPSIN ISEHARA 2	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTICHYMOTRYPSIN SIGNAL PEPTIDE POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPIDOSES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOIDOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral arterial occlusive disease 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SERPINA3-related disorder	Conflicting classifications of pathogenicity; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (200)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	28414889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29125557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	22170383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	16570232, 7479776		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	2327559, 3260956, 3877579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10373494, 16137793, 18248459, 24768341, 33862227, 34668150, 35212939, 40471493, 8617509, 8916107, 9461605, 9880565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	11027208	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ALZHEIMER DISEASE 2	Alzheimer disease	BEFREE	8223557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	11290389, 8730823, 9225693, 9482249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	11106573, 8875763, 9350687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23286751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	17604188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	22580763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	28439213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	27491861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	16570232, 7479776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	28439213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	Pubtator	24015209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22580763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11793783, 2299303, 2327559, 23517041, 25353337, 27736038, 28636794, 28947024, 28984253, 29110960, 29223149, 29692816, 29724395, 30772471, 30831256, 31047107, 31371165 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	23517041, 37146352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	34737220	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22580763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28280732		★★★★★ ★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	11132933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	16968986, 28764996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15811132, 27314662, 29022486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15546506, 33279852, 37414914, 38036545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33569740	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	28636794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19709441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37889066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28019080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32631246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	11289720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	18855268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	11132933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10978037, 11692021, 15935385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	11692021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	10978037, 11289720, 1618300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	1618300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18438953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36144640	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31316093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	10618372, 10849024, 16278826, 21067581, 31431060, 8244391, 9553741		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	40076571	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29459363, 29855767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31560832, 37313408, 38036545, 38087342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31578276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	12050213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16330681, 19638707, 23640964, 28987235, 31670476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30608912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29068691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	29989354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	27213583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	11120905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	11120905	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deep Vein Thrombosis	Thrombosis	BEFREE	20466371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	1974162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	29529166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	10581479, 12509851, 12736093, 16987932, 29605221, 9040504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	10618372, 10954247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	15935385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	10940674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	30498212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	10622342, 27894822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23545169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23545169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31504048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	40076571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11796176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28150914, 9568693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36064366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36304455	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	23545169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10581479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	28711113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	36248880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31423431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	21489304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24817931	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	36500247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	18855268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	25619383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	10462111, 8993482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	16372334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	31316093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	27819410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	27819410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	29625448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25586468, 28844499, 29399139, 29513714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29513714, 35387643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25586468, 28844499, 29399139, 29513714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	12475184, 34449972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20209496, 28458560, 29399139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16330681, 19638707, 23640964, 31670476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25725476, 32638546, 33401250, 33467687, 34725968, 36254001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	31670476	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	29216295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	31815268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11692021, 15718509, 19341158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	29301248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29447737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	15530656, 15653173, 15851726, 17368652, 8916107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	15159602, 8117535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	16968986, 19907165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	10978037, 11692021, 19959196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31316093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	9469262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	17761554, 9484359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoidosis	Lipoidosis	CTD_human_DG	15342952, 16919414, 17175557		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver carcinoma	Liver carcinoma	BEFREE	23295442, 24363202, 28456796, 31121493, 3133443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	11950825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	32038110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	3133443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11120905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	11120905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	10542979, 8228125, 8244391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	40311306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	28120479, 30285245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30285245, 31316093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	8023841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	10536176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	22170383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15546506, 15811132, 27314662, 29022486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31423431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28456796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20514505, 28019080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25393578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11477592, 18383875, 29125557, 9568677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	18383875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25589272, 29855767, 29923026, 30608912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29459363, 29855767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	8228125		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27213583, 30958597, 31278347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27213583, 31278347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	27213583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27894822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	29373933, 30200911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31554846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microspherocytosis	Microspherocytosis	BEFREE	8547071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	18078695, 30577848, 31494860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27557625, 30553167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	28728956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	18056971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28987235, 31439424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	30589994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21437666, 23295442, 25589272, 25644184, 26683520, 28456796, 29145864, 29659051, 31285373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16987932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	21036752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30607521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	11936240, 27894822, 29373933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28974732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
OBSOLETE: Alpha-1-antichymotrypsin deficiency	Alpha-1-Antichymotrypsin Deficiency	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	23549446		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28019080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25393578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21487324, 24571389, 25393578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	25393578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10907731, 11385264, 11956967, 11992569, 9219874, 9932947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	15542006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28954297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28954297		★★★★★ ★☆☆☆☆ Found in Text Mining only
PEROXISOME BIOGENESIS DISORDER, COMPLEMENTATION GROUP A	Zellweger Syndrome	BEFREE	7479776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	10581479, 12509851, 12736093, 16987932, 29605221, 9040504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	30498212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11477592, 18383875, 29125557, 9568677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	11477592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	18383875		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34861864	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36500247	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudotumor Cerebri	intracranial hypertension	BEFREE	3840062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	11936240, 27894822, 29373933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29447737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	10618372, 10954247, 11120905, 21067581, 26783151, 31920121, 37422806, 9553741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34113087	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	12023831, 14694355, 19245336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30608912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	1974162, 28776300, 30299241, 31261500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10474060, 23890736, 24275578, 29477870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	24569695	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	33131208	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	22139032, 23922111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	11132933, 11702211, 12509851, 15530656, 9129722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35681439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	30489041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spermatic Cord Torsion	Spermatic Cord Torsion	BEFREE	31444122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25577251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	9831377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	15718509, 16968986, 19907165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	LHGDN	15718509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	16687568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29720235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	16987932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	10954247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33569740	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	19912235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11692021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	12685871		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

SERPINA3 (serpin family A member 3)