Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1195
Gene name	CDC like kinase 1
Gene symbol	CLK1
Synonyms (NCBI Gene)	CLKCLK/STYSTY
Chromosome	2
Chromosome location	2q33.1
Summary	This gene encodes a member of the CDC2-like (or LAMMER) family of dual specificity protein kinases. In the nucleus, the encoded protein phosphorylates serine/arginine-rich proteins involved in pre-mRNA processing, releasing them into the nucleoplasm. The

Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024633	hsa-miR-215-5p	Microarray	19074876
MIRT026392	hsa-miR-192-5p	Microarray	19074876
MIRT045167	hsa-miR-186-5p	CLASH	23622248
MIRT896631	hsa-miR-3163	CLIP-seq
MIRT896632	hsa-miR-34b	CLIP-seq
MIRT896633	hsa-miR-3653	CLIP-seq
MIRT896634	hsa-miR-3658	CLIP-seq
MIRT896635	hsa-miR-4275	CLIP-seq
MIRT896636	hsa-miR-4427	CLIP-seq
MIRT896637	hsa-miR-4724-5p	CLIP-seq
MIRT896638	hsa-miR-548c-3p	CLIP-seq
MIRT896632	hsa-miR-34b	CLIP-seq
MIRT896636	hsa-miR-4427	CLIP-seq
MIRT2201758	hsa-miR-4680-3p	CLIP-seq
MIRT2201759	hsa-miR-4778-5p	CLIP-seq
MIRT2504778	hsa-miR-1206	CLIP-seq
MIRT2504779	hsa-miR-1236	CLIP-seq
MIRT2504780	hsa-miR-3156-5p	CLIP-seq
MIRT896631	hsa-miR-3163	CLIP-seq
MIRT2504781	hsa-miR-320a	CLIP-seq
MIRT2504782	hsa-miR-320b	CLIP-seq
MIRT2504783	hsa-miR-320c	CLIP-seq
MIRT2504784	hsa-miR-320d	CLIP-seq
MIRT2504785	hsa-miR-3607-3p	CLIP-seq
MIRT896633	hsa-miR-3653	CLIP-seq
MIRT896634	hsa-miR-3658	CLIP-seq
MIRT2504786	hsa-miR-3686	CLIP-seq
MIRT2504787	hsa-miR-4429	CLIP-seq
MIRT2504788	hsa-miR-4718	CLIP-seq
MIRT2504789	hsa-miR-4724-3p	CLIP-seq
MIRT2504790	hsa-miR-520d-5p	CLIP-seq
MIRT2504791	hsa-miR-524-5p	CLIP-seq
MIRT896638	hsa-miR-548c-3p	CLIP-seq
MIRT2504792	hsa-miR-622	CLIP-seq
MIRT2504778	hsa-miR-1206	CLIP-seq
MIRT2504779	hsa-miR-1236	CLIP-seq
MIRT2504780	hsa-miR-3156-5p	CLIP-seq
MIRT896631	hsa-miR-3163	CLIP-seq
MIRT2504785	hsa-miR-3607-3p	CLIP-seq
MIRT2504786	hsa-miR-3686	CLIP-seq
MIRT2504789	hsa-miR-4724-3p	CLIP-seq
MIRT896638	hsa-miR-548c-3p	CLIP-seq
MIRT2504792	hsa-miR-622	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10480872
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0043484	Process	Regulation of RNA splicing	IBA
GO:0043484	Process	Regulation of RNA splicing	IEA
GO:0043484	Process	Regulation of RNA splicing	IMP	19168442
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
601951	2068	ENSG00000013441

P49759

Protein name

Dual specificity protein kinase CLK1 (EC 2.7.12.1) (CDC-like kinase 1)

Protein function

Dual specificity kinase acting on both serine/threonine and tyrosine-containing substrates. Phosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex and may be a constituent of a network of regulatory mechanisms that en

PDB

1Z57 , 2VAG , 5J1V , 5J1W , 5X8I , 6FT8 , 6FT9 , 6FYO , 6G33 , 6I5H , 6I5I , 6I5K , 6I5L , 6KHD , 6Q8K , 6Q8P , 6QTY , 6R3D , 6R6E , 6R6X , 6R8J , 6RAA , 6TW2 , 6YTA , 6YTD , 6YTE , 6YTG , 6YTI , 6Z4Z , 6Z50 , 6ZLN , 7AK3 , 7O9Y , 7OA0 , 7OPG , 8P04 , 8P08 , 8UWN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	161 → 477	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Endothelial cells. {ECO:0000269|PubMed:19168442}.

Sequence

MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESR
SINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIH
HSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL
KKSI

Sequence length

484

Interactions

View interactions

	KEGG
	Legionellosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

CLK1 (CDC like kinase 1)