CLRN3 (clarin 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 119467
Gene name Clarin 3
Gene symbol CLRN3
Synonyms (NCBI Gene)
TMEM12USH3AL1
Chromosome 10
Chromosome location 10q26.2
miRNA miRNA information provided by mirtarbase database.
16
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (16)
miRTarBase ID miRNA Experiments Reference
MIRT897769 hsa-miR-3148 CLIP-seq
MIRT897770 hsa-miR-3153 CLIP-seq
MIRT897771 hsa-miR-4265 CLIP-seq
MIRT897772 hsa-miR-4282 CLIP-seq
MIRT897773 hsa-miR-4296 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (4)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 32814053, 33961781
GO:0007605 Process Sensory perception of sound IEA
GO:0016020 Component Membrane IEA
GO:0070062 Component Extracellular exosome HDA 19056867
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
620256 20795 ENSG00000180745
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NCR9
Protein name Clarin-3 (Transmembrane protein 12) (Usher syndrome type-3A-like protein 1)
Family and domains
Sequence 
MPTTKKTLMFLSSFFTSLGSFIVICSILGTQAWITSTIAVRDSASNGSIFITYGLFRGES
SEELSHGLAEPKKKFAVLEILNNSSQKTLHSVTILFLVLSLITSLLSSGFTFYNSISNPY
QTFLGPTGVYTWNGLGASFVFVTMILFVANTQSNQLSEELFQMLYPATTSKGTTHSYGYS
FWLILLVILLNIVTVTIIIFYQKARYQRKQEQRKPMEYAPRDGILF
Sequence length 226
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PARKINSON DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (2)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Neoplasms Colorectal neoplasm Pubtator 39199281 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease Pubtator 22658654 Associate
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations