GSTO2 (glutathione S-transferase omega 2)

Gene

• Entrez ID: 119391
• Gene name: Glutathione S-transferase omega 2
• Gene symbol: GSTO2
• Synonyms (NCBI Gene): GSTO 2-2, bA127L20.1
• Chromosome: 10
• Chromosome location: 10q25.1
• Summary: The protein encoded by this gene is an omega class glutathione S-transferase (GST). GSTs are involved in the metabolism of xenobiotics and carcinogens. Four transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT681099	hsa-miR-4712-3p	HITS-CLIP	23706177
MIRT681098	hsa-miR-218-2-3p	HITS-CLIP	23706177
MIRT681097	hsa-miR-3158-5p	HITS-CLIP	23706177
MIRT681096	hsa-miR-1184	HITS-CLIP	23706177
MIRT681095	hsa-miR-1205	HITS-CLIP	23706177
MIRT681094	hsa-miR-17-3p	HITS-CLIP	23706177
MIRT681093	hsa-miR-6847-3p	HITS-CLIP	23706177
MIRT681092	hsa-miR-4999-5p	HITS-CLIP	23706177
MIRT681091	hsa-miR-4284	HITS-CLIP	23706177
MIRT681090	hsa-miR-24-3p	HITS-CLIP	23706177
MIRT681089	hsa-miR-182-3p	HITS-CLIP	23706177
MIRT681088	hsa-miR-597-3p	HITS-CLIP	23706177
MIRT681087	hsa-miR-152-5p	HITS-CLIP	23706177
MIRT681086	hsa-miR-6511b-5p	HITS-CLIP	23706177
MIRT681085	hsa-miR-6811-5p	HITS-CLIP	23706177
MIRT681084	hsa-miR-8057	HITS-CLIP	23706177
MIRT681083	hsa-miR-544a	HITS-CLIP	23706177
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657552	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT657551	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT657550	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT657549	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT657548	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657547	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT657546	hsa-miR-1245b-5p	HITS-CLIP	23824327
MIRT657545	hsa-miR-3142	HITS-CLIP	23824327
MIRT657544	hsa-miR-532-5p	HITS-CLIP	23824327
MIRT657543	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT657542	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT657541	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT657540	hsa-miR-578	HITS-CLIP	23824327
MIRT657539	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT681099	hsa-miR-4712-3p	HITS-CLIP	23706177
MIRT681098	hsa-miR-218-2-3p	HITS-CLIP	23706177
MIRT681097	hsa-miR-3158-5p	HITS-CLIP	23706177
MIRT681096	hsa-miR-1184	HITS-CLIP	23706177
MIRT681095	hsa-miR-1205	HITS-CLIP	23706177
MIRT681094	hsa-miR-17-3p	HITS-CLIP	23706177
MIRT681093	hsa-miR-6847-3p	HITS-CLIP	23706177
MIRT681092	hsa-miR-4999-5p	HITS-CLIP	23706177
MIRT681091	hsa-miR-4284	HITS-CLIP	23706177
MIRT681090	hsa-miR-24-3p	HITS-CLIP	23706177
MIRT681089	hsa-miR-182-3p	HITS-CLIP	23706177
MIRT681088	hsa-miR-597-3p	HITS-CLIP	23706177
MIRT681087	hsa-miR-152-5p	HITS-CLIP	23706177
MIRT681086	hsa-miR-6511b-5p	HITS-CLIP	23706177
MIRT681085	hsa-miR-6811-5p	HITS-CLIP	23706177
MIRT681084	hsa-miR-8057	HITS-CLIP	23706177
MIRT681083	hsa-miR-544a	HITS-CLIP	23706177
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657554	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT657553	hsa-miR-1972	HITS-CLIP	23824327
MIRT657552	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT657551	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT657550	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT657549	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT657548	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657547	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT657546	hsa-miR-1245b-5p	HITS-CLIP	23824327
MIRT657545	hsa-miR-3142	HITS-CLIP	23824327
MIRT657544	hsa-miR-532-5p	HITS-CLIP	23824327
MIRT657543	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT657542	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT657541	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT657540	hsa-miR-578	HITS-CLIP	23824327
MIRT657539	hsa-miR-4446-5p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 31515488, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006805	Process	Xenobiotic metabolic process	IDA	15970797
GO:0016491	Function	Oxidoreductase activity	IDA	15970797
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019852	Process	L-ascorbic acid metabolic process	IBA
GO:0019852	Process	L-ascorbic acid metabolic process	IDA	15970797
GO:0019852	Process	L-ascorbic acid metabolic process	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0045174	Function	Glutathione dehydrogenase (ascorbate) activity	IBA
GO:0045174	Function	Glutathione dehydrogenase (ascorbate) activity	IDA	15970797
GO:0045174	Function	Glutathione dehydrogenase (ascorbate) activity	IEA
GO:0050610	Function	Methylarsonate reductase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071243	Process	Cellular response to arsenic-containing substance	IDA	15970797
GO:0071243	Process	Cellular response to arsenic-containing substance	IEA
GO:0098869	Process	Cellular oxidant detoxification	IEA

Other IDs

• MIM: 612314
• HGNC: 23064
• e!Ensembl: ENSG00000065621

Protein

• UniProt ID: Q9H4Y5
• Protein name: Glutathione S-transferase omega-2 (GSTO-2) (EC 2.5.1.18) (Glutathione S-transferase omega 2-2) (GSTO 2-2) (Glutathione-dependent dehydroascorbate reductase) (EC 1.8.5.1) (Monomethylarsonic acid reductase) (MMA(V) reductase) (EC 1.20.4.2)
• Protein function: Exhibits glutathione-dependent thiol transferase activity. Has high dehydroascorbate reductase activity and may contribute to the recycling of ascorbic acid. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsoni
• PDB: 3Q18, 3Q19, 3QAG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13417	GST_N_3	26 → 101	Glutathione S-transferase, N-terminal domain	Domain
  PF13410	GST_C_2	108 → 206		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in a range of tissues, including the liver, kidney, skeletal muscle and prostate. Strongest expression in the testis. {ECO:0000269|PubMed:12618591}.
• Sequence:

  MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
  EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
  CKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
  WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
  GLC

• Sequence length: 243

Pathways

KEGG:

Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Reactome:

Glutathione conjugation
Vitamin C (ascorbate) metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	15040808, 15985314	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	34311603	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20374258, 22040239, 24471578		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	24471578	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22306368		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	22306368		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19859803, 20210239, 23376175, 25300926, 26993125, 28670895		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25835968, 25892883, 27221910	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22306368, 25716313		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30224590	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16761626, 19859803		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	21605854		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	22876127, 23927022		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	22876127	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30417762		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19513904, 22044695		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	30224590		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21113667		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	25395496		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30224590		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36676788	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36676788	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26103006	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	27221910	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15040808		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30224590	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30224590		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	23079717		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25835968, 25892883		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22044695	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25835968	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19859803, 20210239, 23376175, 25300926, 26993125, 28670895		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16761626, 19859803		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18398695		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22306368, 25716313		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	22306368		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15992993, 18398695, 21113667, 21798077, 25300926, 25835968		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25835968, 31738399		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30224590	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29435097, 30224590		★☆☆☆☆ Found in Text Mining only
Nuclear cataract	Cataract	BEFREE	23927022		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	23927022		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30224590		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30224590	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16761626, 19859803		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16761626		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	14570706, 15040808, 15917099, 20472488, 22494505		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	15040808, 15985314	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	17194543	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	25726706		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	25726706		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17903307, 22044695	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30224590		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	17505575	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29323258		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 2	Spinocerebellar Ataxia	BEFREE	28017238		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31738399		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23086268		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18398695		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34925643	Inhibit	★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	25716313		★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	26993125		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	25716313		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22306368, 24040330	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19686770, 21094982		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	29943815		★☆☆☆☆ Found in Text Mining only