Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	1192
Gene name	Chloride intracellular channel 1
Gene symbol	CLIC1
Synonyms (NCBI Gene)	CL1C1CLCNL1G6NCC27
Chromosome	6
Chromosome location	6p21.33
Summary	Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracel

186

Show/Hide all (186)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004124	hsa-miR-192-5p	Microarray	16822819
MIRT004186	hsa-miR-197-3p	Microarray	16822819
MIRT050364	hsa-miR-25-3p	CLASH	23622248
MIRT049437	hsa-miR-92a-3p	CLASH	23622248
MIRT046924	hsa-miR-221-3p	CLASH	23622248
MIRT038667	hsa-miR-183-3p	CLASH	23622248
MIRT038595	hsa-miR-106b-3p	CLASH	23622248
MIRT896218	hsa-miR-122	CLIP-seq
MIRT896219	hsa-miR-1224-3p	CLIP-seq
MIRT896220	hsa-miR-1225-5p	CLIP-seq
MIRT896221	hsa-miR-1260	CLIP-seq
MIRT896222	hsa-miR-1260b	CLIP-seq
MIRT896223	hsa-miR-1280	CLIP-seq
MIRT896224	hsa-miR-2355-3p	CLIP-seq
MIRT896225	hsa-miR-3132	CLIP-seq
MIRT896226	hsa-miR-3198	CLIP-seq
MIRT896227	hsa-miR-3657	CLIP-seq
MIRT896228	hsa-miR-3908	CLIP-seq
MIRT896229	hsa-miR-3942-5p	CLIP-seq
MIRT896230	hsa-miR-4309	CLIP-seq
MIRT896231	hsa-miR-4434	CLIP-seq
MIRT896232	hsa-miR-4516	CLIP-seq
MIRT896233	hsa-miR-4531	CLIP-seq
MIRT896234	hsa-miR-4669	CLIP-seq
MIRT896235	hsa-miR-4694-3p	CLIP-seq
MIRT896236	hsa-miR-4703-5p	CLIP-seq
MIRT896237	hsa-miR-4752	CLIP-seq
MIRT896238	hsa-miR-4766-3p	CLIP-seq
MIRT896239	hsa-miR-4781-3p	CLIP-seq
MIRT896240	hsa-miR-4802-5p	CLIP-seq
MIRT896241	hsa-miR-574-5p	CLIP-seq
MIRT896242	hsa-miR-676	CLIP-seq
MIRT896220	hsa-miR-1225-5p	CLIP-seq
MIRT1965718	hsa-miR-3126-5p	CLIP-seq
MIRT896225	hsa-miR-3132	CLIP-seq
MIRT1965719	hsa-miR-3190	CLIP-seq
MIRT896228	hsa-miR-3908	CLIP-seq
MIRT1965720	hsa-miR-3918	CLIP-seq
MIRT896229	hsa-miR-3942-5p	CLIP-seq
MIRT1965721	hsa-miR-4261	CLIP-seq
MIRT1965722	hsa-miR-4419a	CLIP-seq
MIRT896231	hsa-miR-4434	CLIP-seq
MIRT1965723	hsa-miR-4491	CLIP-seq
MIRT1965724	hsa-miR-4510	CLIP-seq
MIRT1965725	hsa-miR-4512	CLIP-seq
MIRT896232	hsa-miR-4516	CLIP-seq
MIRT896233	hsa-miR-4531	CLIP-seq
MIRT1965726	hsa-miR-4657	CLIP-seq
MIRT1965727	hsa-miR-4685-5p	CLIP-seq
MIRT896235	hsa-miR-4694-3p	CLIP-seq
MIRT896236	hsa-miR-4703-5p	CLIP-seq
MIRT1965728	hsa-miR-4733-3p	CLIP-seq
MIRT896237	hsa-miR-4752	CLIP-seq
MIRT896238	hsa-miR-4766-3p	CLIP-seq
MIRT896240	hsa-miR-4802-5p	CLIP-seq
MIRT896218	hsa-miR-122	CLIP-seq
MIRT896220	hsa-miR-1225-5p	CLIP-seq
MIRT2201638	hsa-miR-1236	CLIP-seq
MIRT896225	hsa-miR-3132	CLIP-seq
MIRT1965719	hsa-miR-3190	CLIP-seq
MIRT896227	hsa-miR-3657	CLIP-seq
MIRT896228	hsa-miR-3908	CLIP-seq
MIRT1965720	hsa-miR-3918	CLIP-seq
MIRT896229	hsa-miR-3942-5p	CLIP-seq
MIRT1965721	hsa-miR-4261	CLIP-seq
MIRT896231	hsa-miR-4434	CLIP-seq
MIRT1965723	hsa-miR-4491	CLIP-seq
MIRT1965725	hsa-miR-4512	CLIP-seq
MIRT896232	hsa-miR-4516	CLIP-seq
MIRT896233	hsa-miR-4531	CLIP-seq
MIRT1965726	hsa-miR-4657	CLIP-seq
MIRT896234	hsa-miR-4669	CLIP-seq
MIRT1965727	hsa-miR-4685-5p	CLIP-seq
MIRT896235	hsa-miR-4694-3p	CLIP-seq
MIRT896236	hsa-miR-4703-5p	CLIP-seq
MIRT1965728	hsa-miR-4733-3p	CLIP-seq
MIRT896237	hsa-miR-4752	CLIP-seq
MIRT896238	hsa-miR-4766-3p	CLIP-seq
MIRT896240	hsa-miR-4802-5p	CLIP-seq
MIRT896241	hsa-miR-574-5p	CLIP-seq
MIRT2201639	hsa-miR-665	CLIP-seq
MIRT896218	hsa-miR-122	CLIP-seq
MIRT896219	hsa-miR-1224-3p	CLIP-seq
MIRT896220	hsa-miR-1225-5p	CLIP-seq
MIRT2201638	hsa-miR-1236	CLIP-seq
MIRT896221	hsa-miR-1260	CLIP-seq
MIRT896222	hsa-miR-1260b	CLIP-seq
MIRT896223	hsa-miR-1280	CLIP-seq
MIRT2504523	hsa-miR-193a-3p	CLIP-seq
MIRT2504524	hsa-miR-193b	CLIP-seq
MIRT896224	hsa-miR-2355-3p	CLIP-seq
MIRT2504525	hsa-miR-302a	CLIP-seq
MIRT2504526	hsa-miR-302b	CLIP-seq
MIRT2504527	hsa-miR-302c	CLIP-seq
MIRT2504528	hsa-miR-302d	CLIP-seq
MIRT2504529	hsa-miR-302e	CLIP-seq
MIRT2504530	hsa-miR-3124-3p	CLIP-seq
MIRT896225	hsa-miR-3132	CLIP-seq
MIRT2504531	hsa-miR-3187-3p	CLIP-seq
MIRT1965719	hsa-miR-3190	CLIP-seq
MIRT896226	hsa-miR-3198	CLIP-seq
MIRT896227	hsa-miR-3657	CLIP-seq
MIRT2504532	hsa-miR-372	CLIP-seq
MIRT2504533	hsa-miR-373	CLIP-seq
MIRT896228	hsa-miR-3908	CLIP-seq
MIRT1965720	hsa-miR-3918	CLIP-seq
MIRT2504534	hsa-miR-3938	CLIP-seq
MIRT896229	hsa-miR-3942-5p	CLIP-seq
MIRT1965721	hsa-miR-4261	CLIP-seq
MIRT896230	hsa-miR-4309	CLIP-seq
MIRT896231	hsa-miR-4434	CLIP-seq
MIRT2504535	hsa-miR-4446-5p	CLIP-seq
MIRT1965723	hsa-miR-4491	CLIP-seq
MIRT1965725	hsa-miR-4512	CLIP-seq
MIRT896232	hsa-miR-4516	CLIP-seq
MIRT2504536	hsa-miR-4529-5p	CLIP-seq
MIRT896233	hsa-miR-4531	CLIP-seq
MIRT1965726	hsa-miR-4657	CLIP-seq
MIRT896234	hsa-miR-4669	CLIP-seq
MIRT1965727	hsa-miR-4685-5p	CLIP-seq
MIRT896236	hsa-miR-4703-5p	CLIP-seq
MIRT1965728	hsa-miR-4733-3p	CLIP-seq
MIRT896237	hsa-miR-4752	CLIP-seq
MIRT2504537	hsa-miR-4755-5p	CLIP-seq
MIRT896238	hsa-miR-4766-3p	CLIP-seq
MIRT896239	hsa-miR-4781-3p	CLIP-seq
MIRT2504538	hsa-miR-520a-3p	CLIP-seq
MIRT2504539	hsa-miR-520b	CLIP-seq
MIRT2504540	hsa-miR-520c-3p	CLIP-seq
MIRT2504541	hsa-miR-520d-3p	CLIP-seq
MIRT2504542	hsa-miR-520e	CLIP-seq
MIRT896241	hsa-miR-574-5p	CLIP-seq
MIRT2504543	hsa-miR-642a	CLIP-seq
MIRT2201639	hsa-miR-665	CLIP-seq
MIRT2504544	hsa-miR-670	CLIP-seq
MIRT896242	hsa-miR-676	CLIP-seq
MIRT896218	hsa-miR-122	CLIP-seq
MIRT896220	hsa-miR-1225-5p	CLIP-seq
MIRT2201638	hsa-miR-1236	CLIP-seq
MIRT2504523	hsa-miR-193a-3p	CLIP-seq
MIRT2504524	hsa-miR-193b	CLIP-seq
MIRT2504525	hsa-miR-302a	CLIP-seq
MIRT2504526	hsa-miR-302b	CLIP-seq
MIRT2504527	hsa-miR-302c	CLIP-seq
MIRT2504528	hsa-miR-302d	CLIP-seq
MIRT2504529	hsa-miR-302e	CLIP-seq
MIRT2504530	hsa-miR-3124-3p	CLIP-seq
MIRT896225	hsa-miR-3132	CLIP-seq
MIRT2504531	hsa-miR-3187-3p	CLIP-seq
MIRT1965719	hsa-miR-3190	CLIP-seq
MIRT896226	hsa-miR-3198	CLIP-seq
MIRT896227	hsa-miR-3657	CLIP-seq
MIRT2504532	hsa-miR-372	CLIP-seq
MIRT2504533	hsa-miR-373	CLIP-seq
MIRT896228	hsa-miR-3908	CLIP-seq
MIRT1965720	hsa-miR-3918	CLIP-seq
MIRT2504534	hsa-miR-3938	CLIP-seq
MIRT896229	hsa-miR-3942-5p	CLIP-seq
MIRT1965721	hsa-miR-4261	CLIP-seq
MIRT896230	hsa-miR-4309	CLIP-seq
MIRT896231	hsa-miR-4434	CLIP-seq
MIRT2504535	hsa-miR-4446-5p	CLIP-seq
MIRT1965723	hsa-miR-4491	CLIP-seq
MIRT1965725	hsa-miR-4512	CLIP-seq
MIRT896232	hsa-miR-4516	CLIP-seq
MIRT2504536	hsa-miR-4529-5p	CLIP-seq
MIRT896233	hsa-miR-4531	CLIP-seq
MIRT1965726	hsa-miR-4657	CLIP-seq
MIRT896234	hsa-miR-4669	CLIP-seq
MIRT1965727	hsa-miR-4685-5p	CLIP-seq
MIRT896235	hsa-miR-4694-3p	CLIP-seq
MIRT896236	hsa-miR-4703-5p	CLIP-seq
MIRT1965728	hsa-miR-4733-3p	CLIP-seq
MIRT896237	hsa-miR-4752	CLIP-seq
MIRT2504537	hsa-miR-4755-5p	CLIP-seq
MIRT896238	hsa-miR-4766-3p	CLIP-seq
MIRT896240	hsa-miR-4802-5p	CLIP-seq
MIRT2504538	hsa-miR-520a-3p	CLIP-seq
MIRT2504539	hsa-miR-520b	CLIP-seq
MIRT2504540	hsa-miR-520c-3p	CLIP-seq
MIRT2504541	hsa-miR-520d-3p	CLIP-seq
MIRT2504542	hsa-miR-520e	CLIP-seq
MIRT896241	hsa-miR-574-5p	CLIP-seq
MIRT2504543	hsa-miR-642a	CLIP-seq
MIRT2201639	hsa-miR-665	CLIP-seq
MIRT2504544	hsa-miR-670	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005254	Function	Chloride channel activity	IBA
GO:0005254	Function	Chloride channel activity	IDA	9139710
GO:0005254	Function	Chloride channel activity	IEA
GO:0005515	Function	Protein binding	IPI	12163479, 12681486, 14667819, 24338975, 26618866, 28514442, 29924966, 31324722, 32296183, 35156780, 36012204
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	HDA	16791210
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	16130169
GO:0005635	Component	Nuclear envelope	IDA	9139710
GO:0005737	Component	Cytoplasm	HDA	16791210
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10793131
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005903	Component	Brush border	TAS	10793131
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IBA
GO:0006821	Process	Chloride transport	IDA	9139710
GO:0006821	Process	Chloride transport	IEA
GO:0007165	Process	Signal transduction	TAS	16130169
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12681486
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070062	Component	Extracellular exosome	IDA	15326289
GO:0070527	Process	Platelet aggregation	HMP	23382103
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1902476	Process	Chloride transmembrane transport	IEA

MIM	HGNC	e!Ensembl
602872	2062	ENSG00000213719

O00299

Protein name

Chloride intracellular channel protein 1 (Chloride channel ABP) (Glutaredoxin-like oxidoreductase CLIC1) (EC 1.8.-.-) (Glutathione-dependent dehydroascorbate reductase CLIC1) (EC 1.8.5.1) (Nuclear chloride ion channel 27) (NCC27) (Regulatory nuclear chlor

Protein function

In the soluble state, catalyzes glutaredoxin-like thiol disulfide exchange reactions with reduced glutathione as electron donor. Reduces selenite and dehydroascorbate and may act as an antioxidant during oxidative stress response (PubMed:2558102

PDB

1K0M , 1K0N , 1K0O , 1RK4 , 3O3T , 3P8W , 3P90 , 3QR6 , 3SWL , 3TGZ , 3UVH , 4IQA , 4JZQ , 4K0G , 4K0N , 7F8R , 7FBQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13409	GST_N_2	23 → 87	Glutathione S-transferase, N-terminal domain	Domain
PF13410	GST_C_2	123 → 211		Domain

Tissue specificity

TISSUE SPECIFICITY: Expression is prominent in heart, placenta, liver, kidney and pancreas. {ECO:0000269|PubMed:10793131}.

Sequence

MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCP
GGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKN
SNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNL
LPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKAL
K

Sequence length

241

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MASTOCYTOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC MASTOCYTOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC EPIDERMAL NECROLYSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (83)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	27461670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27861612, 28970012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	34410943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34410943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34177888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27861612, 28970012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	39864423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	31106658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30918838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20005186	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	27461670, 30229897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31364737, 34766585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35722791	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	29462791	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25582317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	30282979	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27461670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31243111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25582317, 27825122, 29061300, 29805518, 30282979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	27716384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	25227665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	25227665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	27983917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22426742, 25227665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18710659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31636470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18710659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24587680, 25227665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31243111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22415234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25582317, 27825122, 29805518, 30282979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34148879	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	19299076, 25227665, 28378944, 28944858, 29516682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	25227665, 28378944, 29516682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	22173998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18590702, 29147652, 30135216, 30186163, 30279961, 30918838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35135603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29147652, 30135216, 30186163, 30279961, 30918838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22578365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22578365, 35135603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	33754492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	21330840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24989236, 25661391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37924785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	23593969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31316050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	25661391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36181109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25227665, 28378944, 28944858, 29516682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31364737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29061300, 29805518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25920608, 31636470, 31834994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25279971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22173998, 22791942, 25227665, 29669336, 31473882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22578365, 25205595, 25546839, 29796185, 30519049, 30899362, 30918838, 31316050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22426742, 25227665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	29462791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36264759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30553167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22578365, 23593969, 25546839, 27461670, 27716384, 27825122, 29669336, 29796185, 30135216, 30519049, 30918838, 31243111, 31316050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29061300, 29805518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25582317	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25920608, 31636470, 31834994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	36671463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	25582317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25279971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	36264759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	21156761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24661138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30519049, 30899362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	21517111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29796185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22173998, 22791942, 25227665, 29669336, 31473882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22791942, 25227665, 26497050, 35260554, 37104099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Malformations	Vascular malformation	Pubtator	27716384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	34410943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CLIC1 (chloride intracellular channel 1)