CLU (clusterin)

Gene

• Entrez ID: 1191
• Gene name: Clusterin
• Gene symbol: CLU
• Synonyms (NCBI Gene): AAG4, APO-J, APOJ, CLI, CLU1, CLU2, KUB1, NA1/NA2, SGP-2, SGP2, SP-40, TRPM-2, TRPM2
• Chromosome: 8
• Chromosome location: 8p21.1
• Summary: The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegen

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT040971	hsa-miR-18a-3p	CLASH	23622248
MIRT039321	hsa-miR-425-5p	CLASH	23622248
MIRT437882	hsa-miR-17-5p	Immunohistochemistry, qRT-PCR, Western blot	23436804
MIRT438224	hsa-miR-21-5p	Luciferase reporter assay	24327270
MIRT438224	hsa-miR-21-5p	Luciferase reporter assay	24327270
MIRT732481	hsa-miR-217	Luciferase reporter assay, qRT-PCR, Western blotting	33993322
MIRT898248	hsa-miR-15a	CLIP-seq
MIRT898249	hsa-miR-15b	CLIP-seq
MIRT898250	hsa-miR-16	CLIP-seq
MIRT898251	hsa-miR-195	CLIP-seq
MIRT898252	hsa-miR-2053	CLIP-seq
MIRT898253	hsa-miR-2116	CLIP-seq
MIRT898254	hsa-miR-3123	CLIP-seq
MIRT898255	hsa-miR-361-5p	CLIP-seq
MIRT898256	hsa-miR-3919	CLIP-seq
MIRT898257	hsa-miR-424	CLIP-seq
MIRT898258	hsa-miR-4468	CLIP-seq
MIRT898259	hsa-miR-4652-3p	CLIP-seq
MIRT898260	hsa-miR-4677-5p	CLIP-seq
MIRT898261	hsa-miR-4756-3p	CLIP-seq
MIRT898262	hsa-miR-4778-5p	CLIP-seq
MIRT898263	hsa-miR-497	CLIP-seq
MIRT898264	hsa-miR-569	CLIP-seq
MIRT898265	hsa-miR-1184	CLIP-seq
MIRT898266	hsa-miR-1301	CLIP-seq
MIRT898248	hsa-miR-15a	CLIP-seq
MIRT898249	hsa-miR-15b	CLIP-seq
MIRT898250	hsa-miR-16	CLIP-seq
MIRT898251	hsa-miR-195	CLIP-seq
MIRT898252	hsa-miR-2053	CLIP-seq
MIRT898253	hsa-miR-2116	CLIP-seq
MIRT898254	hsa-miR-3123	CLIP-seq
MIRT898255	hsa-miR-361-5p	CLIP-seq
MIRT898256	hsa-miR-3919	CLIP-seq
MIRT898267	hsa-miR-409-5p	CLIP-seq
MIRT898257	hsa-miR-424	CLIP-seq
MIRT898268	hsa-miR-4418	CLIP-seq
MIRT898258	hsa-miR-4468	CLIP-seq
MIRT898259	hsa-miR-4652-3p	CLIP-seq
MIRT898269	hsa-miR-4660	CLIP-seq
MIRT898270	hsa-miR-4667-5p	CLIP-seq
MIRT898260	hsa-miR-4677-5p	CLIP-seq
MIRT898271	hsa-miR-4690-3p	CLIP-seq
MIRT898272	hsa-miR-4700-5p	CLIP-seq
MIRT898261	hsa-miR-4756-3p	CLIP-seq
MIRT898262	hsa-miR-4778-5p	CLIP-seq
MIRT898263	hsa-miR-497	CLIP-seq
MIRT898273	hsa-miR-5047	CLIP-seq
MIRT898274	hsa-miR-509-3-5p	CLIP-seq
MIRT898275	hsa-miR-509-5p	CLIP-seq
MIRT898264	hsa-miR-569	CLIP-seq
MIRT898276	hsa-miR-637	CLIP-seq
MIRT898265	hsa-miR-1184	CLIP-seq
MIRT898266	hsa-miR-1301	CLIP-seq
MIRT898248	hsa-miR-15a	CLIP-seq
MIRT898249	hsa-miR-15b	CLIP-seq
MIRT898250	hsa-miR-16	CLIP-seq
MIRT898251	hsa-miR-195	CLIP-seq
MIRT898253	hsa-miR-2116	CLIP-seq
MIRT898267	hsa-miR-409-5p	CLIP-seq
MIRT898257	hsa-miR-424	CLIP-seq
MIRT898258	hsa-miR-4468	CLIP-seq
MIRT898259	hsa-miR-4652-3p	CLIP-seq
MIRT898269	hsa-miR-4660	CLIP-seq
MIRT898270	hsa-miR-4667-5p	CLIP-seq
MIRT898260	hsa-miR-4677-5p	CLIP-seq
MIRT898272	hsa-miR-4700-5p	CLIP-seq
MIRT1966363	hsa-miR-4701-5p	CLIP-seq
MIRT898262	hsa-miR-4778-5p	CLIP-seq
MIRT898263	hsa-miR-497	CLIP-seq
MIRT898273	hsa-miR-5047	CLIP-seq
MIRT1966364	hsa-miR-588	CLIP-seq
MIRT898276	hsa-miR-637	CLIP-seq
MIRT2202226	hsa-miR-1245b-3p	CLIP-seq
MIRT898248	hsa-miR-15a	CLIP-seq
MIRT898249	hsa-miR-15b	CLIP-seq
MIRT898250	hsa-miR-16	CLIP-seq
MIRT898251	hsa-miR-195	CLIP-seq
MIRT898257	hsa-miR-424	CLIP-seq
MIRT2202227	hsa-miR-4330	CLIP-seq
MIRT2202228	hsa-miR-4452	CLIP-seq
MIRT898263	hsa-miR-497	CLIP-seq
MIRT898248	hsa-miR-15a	CLIP-seq
MIRT898249	hsa-miR-15b	CLIP-seq
MIRT898250	hsa-miR-16	CLIP-seq
MIRT898251	hsa-miR-195	CLIP-seq
MIRT898253	hsa-miR-2116	CLIP-seq
MIRT898267	hsa-miR-409-5p	CLIP-seq
MIRT898257	hsa-miR-424	CLIP-seq
MIRT2505118	hsa-miR-4328	CLIP-seq
MIRT2202228	hsa-miR-4452	CLIP-seq
MIRT898258	hsa-miR-4468	CLIP-seq
MIRT898259	hsa-miR-4652-3p	CLIP-seq
MIRT898260	hsa-miR-4677-5p	CLIP-seq
MIRT898262	hsa-miR-4778-5p	CLIP-seq
MIRT898263	hsa-miR-497	CLIP-seq
MIRT2505119	hsa-miR-520d-5p	CLIP-seq
MIRT2505120	hsa-miR-524-5p	CLIP-seq
MIRT2505121	hsa-miR-548a-3p	CLIP-seq
MIRT2505122	hsa-miR-548e	CLIP-seq
MIRT2505123	hsa-miR-548f	CLIP-seq
MIRT2505124	hsa-miR-600	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOS	Repression	10406964
FOSL1	Unknown	10406964
FOSL2	Unknown	10406964
JUNB	Unknown	10406964
JUND	Unknown	10406964
MYCN	Repression	23362253

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IDA	15857407
GO:0001540	Function	Amyloid-beta binding	IDA	22179788
GO:0001540	Function	Amyloid-beta binding	IPI	9228033, 23106396
GO:0001774	Process	Microglial cell activation	IDA	15857407
GO:0001836	Process	Release of cytochrome c from mitochondria	IC	16113678
GO:0001971	Process	Negative regulation of activation of membrane attack complex	IDA	9200695, 34667172
GO:0002376	Process	Immune system process	IEA
GO:0002434	Process	Immune complex clearance	IEA
GO:0002434	Process	Immune complex clearance	ISS
GO:0005102	Function	Signaling receptor binding	IPI	27477018
GO:0005515	Function	Protein binding	IPI	8555189, 16113678, 17043677, 17170699, 17567961, 20195357, 21567405, 22179788, 22528093, 22689054, 23805218, 25051234, 25451228, 26496610, 28887769, 31270237, 31413325, 32814053
GO:0005576	Component	Extracellular region	HDA	20551380
GO:0005576	Component	Extracellular region	HDA	27068509, 27559042
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	23164821, 25051234
GO:0005615	Component	Extracellular space	HDA	16502470, 20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	30333625
GO:0005615	Component	Extracellular space	IDA	11123922, 16113678, 17567961, 19996109
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19137541, 25051234
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	9560017, 17689225, 22689054, 25051234
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	23164821
GO:0005739	Component	Mitochondrion	IDA	16113678, 22689054
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	17689225
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0005829	Component	Cytosol	IDA	22689054
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IDA	25051234
GO:0005886	Component	Plasma membrane	IDA	30333625
GO:0006457	Process	Protein folding	IDA	11123922
GO:0006629	Process	Lipid metabolic process	NAS	2387851
GO:0006915	Process	Apoptotic process	IEA
GO:0006956	Process	Complement activation	IDA	30552328
GO:0006956	Process	Complement activation	TAS	1585460
GO:0006958	Process	Complement activation, classical pathway	IEA
GO:0009615	Process	Response to virus	IEP	16548883
GO:0009986	Component	Cell surface	IDA	17567961
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0016020	Component	Membrane	IDA	25051234
GO:0016020	Component	Membrane	IEA
GO:0016887	Function	ATP hydrolysis activity	IDA	11123922
GO:0017038	Process	Protein import	IDA	24446231
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IDA	22179788, 23106396
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	16113678
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	22179788
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	20068069
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032286	Process	Central nervous system myelin maintenance	IMP	21543606
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	20068069
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	15857407
GO:0032991	Component	Protein-containing complex	IDA	9228033, 17567961
GO:0032991	Component	Protein-containing complex	TAS	25051234
GO:0034366	Component	Spherical high-density lipoprotein particle	IDA	16682745
GO:0042127	Process	Regulation of cell population proliferation	IMP	19137541
GO:0042583	Component	Chromaffin granule	IEA
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	21567405
GO:0043065	Process	Positive regulation of apoptotic process	ISS
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	22689054
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0043691	Process	Reverse cholesterol transport	TAS	16682745
GO:0044877	Function	Protein-containing complex binding	IPI	22179788, 23106396
GO:0045087	Process	Innate immune response	IEA
GO:0045202	Component	Synapse	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	15857407
GO:0045916	Process	Negative regulation of complement activation	IDA	9200695, 34667172
GO:0046982	Function	Protein heterodimerization activity	TAS	25051234
GO:0048018	Function	Receptor ligand activity	IDA	27477018
GO:0048156	Function	Tau protein binding	IPI	25051234
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	IGI	9228033
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20068069, 21567405
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IPI	9228033
GO:0050821	Process	Protein stabilization	IDA	11123922, 12176985
GO:0051082	Function	Unfolded protein binding	IMP	25402950
GO:0051087	Function	Protein-folding chaperone binding	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	20068069
GO:0051131	Process	Chaperone-mediated protein complex assembly	IDA	17412999
GO:0051787	Function	Misfolded protein binding	IBA
GO:0051787	Function	Misfolded protein binding	IDA	11123922
GO:0051787	Function	Misfolded protein binding	IPI	19996109
GO:0051788	Process	Response to misfolded protein	IDA	19996109
GO:0061518	Process	Microglial cell proliferation	IDA	15857407
GO:0061740	Process	Protein targeting to lysosome involved in chaperone-mediated autophagy	IDA	9228033
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0071944	Component	Cell periphery	IDA	21803450
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	TAS	21803450
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IDA	21567405
GO:0097242	Process	Amyloid-beta clearance	IDA	27477018
GO:0097242	Process	Amyloid-beta clearance	IDA	27477018
GO:0097418	Component	Neurofibrillary tangle	IDA	9560017, 15897157
GO:0097440	Component	Apical dendrite	IDA	9560017
GO:0099020	Component	Perinuclear endoplasmic reticulum lumen	IDA	22689054
GO:0140311	Function	Protein sequestering activity	IDA	9200695, 34667172
GO:0140597	Function	Protein carrier chaperone	IDA	9228033
GO:1900221	Process	Regulation of amyloid-beta clearance	IDA	24446231
GO:1902004	Process	Positive regulation of amyloid-beta formation	IEA
GO:1902004	Process	Positive regulation of amyloid-beta formation	ISS
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	16113678
GO:1902430	Process	Negative regulation of amyloid-beta formation	IDA	12047389, 17412999
GO:1902847	Process	Regulation of neuronal signal transduction	IMP	21397462
GO:1902998	Process	Positive regulation of neurofibrillary tangle assembly	IMP	15897157
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	IMP	21803450
GO:1903660	Process	Negative regulation of complement-dependent cytotoxicity	IDA	9200695, 34667172
GO:1905907	Process	Negative regulation of amyloid fibril formation	IDA	22179788
GO:1905907	Process	Negative regulation of amyloid fibril formation	IEA
GO:1905907	Process	Negative regulation of amyloid fibril formation	TAS	9228033, 23106396
GO:1905908	Process	Positive regulation of amyloid fibril formation	TAS	20005821
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IMP	20068069
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	21567405

Other IDs

• MIM: 185430
• HGNC: 2095
• e!Ensembl: ENSG00000120885

Protein

• UniProt ID: P10909
• Protein name: Clusterin (Aging-associated gene 4 protein) (Apolipoprotein J) (Apo-J) (Complement cytolysis inhibitor) (CLI) (Complement-associated protein SP-40,40) (Ku70-binding protein 1) (NA1/NA2) (Sulfated glycoprotein 2) (SGP-2) (Testosterone-repressed prostate me
• Protein function: [Isoform 1]: Functions as extracellular chaperone that prevents aggregation of non native proteins (PubMed:11123922, PubMed:19535339). Prevents stress-induced aggregation of blood plasma proteins (PubMed:11123922, PubMed:12176985, PubMed:1726097
• PDB: 7ZET, 7ZEU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01093	Clusterin	30 → 447	Clusterin	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in blood plasma, cerebrospinal fluid, milk, seminal plasma and colon mucosa. Detected in the germinal center of colon lymphoid nodules and in colon parasympathetic ganglia of the Auerbach plexus (at protein level). Ubiquitous.
• Sequence:

  MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLI
  EKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQT
  CMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHF
  SRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNF
  HAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKD
  QCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLE
  QLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP
  VEVSRKNPKFMETVAEKALQEYRKKHREE

• Sequence length: 449

Pathways

KEGG:

Complement and coagulation cascades

Reactome:

Platelet degranulation
Terminal pathway of complement
Antimicrobial peptides
Regulation of Complement cascade

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Alzheimer disease	Likely benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLU-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITIVE DYSFUNCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS, INCLUSION BODY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	19734902, 19734903, 21460841		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	23349247		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	20118187, 20623750, 22005293, 23052191, 24361871, 28885000		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18709641		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21995960, 23276503, 28902909		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	15026542, 19166932, 23276503, 28954633, 29296216		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15929184, 21464964		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15492264		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	17148042, 28944909		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	23649770		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10666378, 15912881, 1924317, 19734902, 19734903, 20209083, 20534741, 20554627, 20697030, 20739100, 21220176, 21347408, 21379329, 21447104, 21543606, 21824521, 21912625, 22015308, 22046305, 22159129, 22179788, 22248099, 22506010, 22508715, 22539578, 22701550, 22795969, 22906254, 22952074, 23360175, 23419238, 23573206, 23643458, 23805218, 23954108, 24023061, 24244428, 24670887, 24743338, 24806679, 24967550, 25189118, 25402950, 25723573, 25778476, 26179372, 26243271, 26510741, 26545630, 26625115, 26680604, 26738351, 26976043, 27017968, 27143425, 27229352, 27396407, 27482534, 27781389, 28025282, 28084078, 28199971, 28233427, 29324756, 29860944, 30967152, 31664702, 32555747, 32709662, 32986668, 32991610, 32992916, 33003328, 33152068, 33804666, 34092785, 34650147, 34752346, 34767070, 35307406, 35436980, 35640139, 35811524, 36181103, 36291126, 36329114, 36411364, 36550123, 36951251, 37047762, 37480051, 37494190, 37611586, 37658429, 38233149, 38241287, 40631452	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Alzheimer Disease	Alzheimer disease	Pubtator	23226438, 27248362	Stimulate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	19734902, 19734903, 21460841		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	27229352, 28558636		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	19734902, 19734903, 21460841		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	20460622, 20554627, 20739100, 20930273, 21132329, 21321396, 21379329, 21543606, 21912625, 22015308, 22122982, 22296908, 22402018, 22722634, 23411014, 23643458, 23954108, 24806679, 25189118, 27017968, 27076484, 27229352, 27396407, 27897113, 29504051, 30795987, 31738162		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	19734902, 19734903, 21460841		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	19734902, 19734903, 21460841, 24162737		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	19734902, 19734903, 21460841, 24162737, 25778476, 29777097, 30617256, 30805717, 31473137		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	19734902, 19734903, 21460841		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	19664600, 22155582, 23164821, 24199960, 26661731, 27229352, 28698646, 29169407, 30090055		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	19664600		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29115989, 31386770		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31386770	Stimulate	★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	10471215		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	34867780	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	30465328		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	16639006		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28428074		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	11502446		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	23704777	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26365974, 29370749, 29417939, 29534716, 30281685, 8169523, 8314591, 9109446		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	37033956, 39684771	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39684771	Associate	★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	22902018		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29200898, 30876376		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30876376	Associate	★☆☆☆☆ Found in Text Mining only
Asthma, Occupational	Asthma	BEFREE	29717106		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	7526972		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18712185, 23704777, 25402950	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	24758255	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	26365974, 29370749, 29417939, 29534716, 30281685, 8169523, 8314591, 9109446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	32389013	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	24670887	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	26661731, 27543695, 28701379, 29370749, 29860944, 30691533		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27148688		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21891868, 25025927		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	29682100		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30560838		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	33715293	Stimulate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	39676317	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11751526, 15126879, 15802022, 15809754, 22895628, 31114318		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15809754		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	21467285, 22274961, 28698646		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	19734903	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	31460820		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	1924317		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10934144, 15685647, 16373699, 17689225, 17722531, 18078515, 18508997, 19903745, 20307318, 22037783, 22369881, 22613415, 23099883, 23174100, 25144344, 28890185, 31273033, 31428526, 8252481		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10823943, 17121433, 17689225, 18078515, 18813793, 19846927, 20920219, 37268731	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10934144, 14755245, 22106898	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28076321	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	30850364	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	27893721		★☆☆☆☆ Found in Text Mining only
Brugada Syndrome	Brugada syndrome	Pubtator	23276942	Stimulate	★☆☆☆☆ Found in Text Mining only
CADASIL Syndrome	CADASIL Syndrome	BEFREE	21555590		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	18974881	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	14755245, 15929184, 19118032, 20028970, 22185350, 25574066, 26916071, 37686218	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10934144, 15578711, 16675913, 19879420, 19940549, 26916071, 8049130		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	15467709	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22272636, 22949882, 24614035, 25600802, 26264614, 32039450, 32059741, 33054843, 34290294, 34837478, 36482717	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	19846927	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	26916071	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	10934144	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11751526, 15126879, 15802022, 15809754, 22895628, 31114318		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15026542, 15770517, 19879423, 21630085, 23276503, 28294391, 28954633, 29686328		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19550125, 19709441, 30917846	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36694355	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18079682, 8196285, 8263017	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24814677	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26916071, 28954633	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	19757199	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	18514801		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	LHGDN	18514801		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	17322305, 29420353		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15578711, 19391138, 22185350, 23208459, 26293319, 29970704, 31540420		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	29540862	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	32516132	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29540862		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26365974, 28958138, 30659075		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35439851	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	24758255	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	15883054		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	30952532		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	11795992	Inhibit	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	34686774	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	27248362, 29370749, 30691533		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	27248362, 29860944, 36181103	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	27543695	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	21467285, 22274961, 28698646		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	36181103	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30465328		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	26159191		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18177691		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18177691		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	31161800		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	19413638		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	30206409		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	30206409	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28391884		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 3	Kidney Disease	BEFREE	28434209		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	29511890		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28434209, 28476556, 29563234		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	20149216		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19413638, 29427759		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	23266720		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21824521, 22952074, 24244428, 24768341, 31386770	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30560405		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	21824521, 25189118, 26503441, 26976043, 28025282, 28233427, 30149449, 34752346	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognitive Dysfunction	Cognition disorder	Pubtator	36472389	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	15492264, 18055195, 18180384, 19177010, 19879422, 24085798, 25917404, 26399194		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	14755245	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15492264		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15929184, 17322305, 18055195, 19177010, 19879422, 26399194, 26537064, 28849249, 29628342, 31672651		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14508108, 15929184, 16854844, 17322305, 19177010, 25884309, 25917404, 29279586, 32023884, 36267311, 37024866	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26537064	Stimulate	★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	23266720		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28391884, 29891738		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11714447, 11956479, 18079682, 23670677, 27526062, 29400663		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21508640		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21508640, 31534454		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24758255	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18712185, 35439851	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11557671, 21508640		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	18712185		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	18712185	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11510965		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	25250685	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	8196285	Associate	★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	Pubtator	25071085	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17056579, 21753128, 30967152		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	17568789, 18784066		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	21297263, 22701550, 24806679, 36951251, 37328865	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	BEFREE	24806679, 26159191, 29067960, 29534716, 29698690, 30291488, 30791945, 9878186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia, familial Danish	Dementia	BEFREE	16972883		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30291488		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23209684		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	23209684, 28233427	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20850846, 28973302, 31614179		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20850846, 28958138, 28973302, 31614179		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18092746	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27070750	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32235466	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20850846, 28316001, 28434209, 28638999		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32913257	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34124269, 34545296, 35991124	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28434209, 28701152		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26665153	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	24297113		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	LHGDN	17535098		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	10666378, 24438528	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15126113		★☆☆☆☆ Found in Text Mining only
Drusen	Drusen	BEFREE	17148042		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30077709		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	20847305	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	35191419	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18514801, 22211095		★☆☆☆☆ Found in Text Mining only
Endometrial Diseases	Endometrial Diseases	BEFREE	23589125		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17503403	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18514801		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22211095, 39326337	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	1924317, 28972394		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	23266720		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23208459, 29970704		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	15955107, 23208459		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15133840	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15133840, 19793084, 25574066, 36157541	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15925890		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	16639006, 18806885, 25057782, 25849827, 26272660, 28450942, 29547474, 29965900, 31765245		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	LHGDN	18806885		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	19734902, 19734903, 21460841		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29229391		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	11085517		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	19413638, 29427759, 31739636		★☆☆☆☆ Found in Text Mining only
Fish-Eye Disease	Fish-Eye Disease	BEFREE	18378577, 22234156		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	24833739		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	26159191, 30291488		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	18378577, 19011008, 22234156, 28726551		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	18378577	Stimulate	★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	19011008, 22234156	Associate	★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	23266720		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	29420353	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	16639006, 31765245		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	16639006		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	1660393, 26678675		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37686218	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	1660393, 26678675		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32597148, 37686218	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	16775601	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	17847104		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	7518800	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	26599235	Stimulate	★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Graves ophthalmopathy	Pubtator	28707765	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29891738		★☆☆☆☆ Found in Text Mining only
Heart Failure Systolic	Heart failure	Pubtator	36797157	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	18079682		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	LHGDN	18079682		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	10872662		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	15467709	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	19446882		★☆☆☆☆ Found in Text Mining only
Hemorrhagic Fever with Renal Syndrome	Hemorrhagic fever with renal syndrome	Pubtator	29682100	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	36243044	Associate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	22130675		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	33683746	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	12429802		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	36077307	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	LHGDN	12427144		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	15925890		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	21467285, 29860944		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	24599003	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	17847104		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19401549, 24943969		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21390209, 22795969, 22952074, 24244428, 28631188, 29169407, 30295351, 31386770		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	CTD_human_DG	30503753		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	34341430, 36142505	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20847305	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	18180384		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	23266720		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	BEFREE	27198502		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37108600	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	10887098, 29420353		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	12429802		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	21258088, 21593213, 24863737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	25071085, 33715293, 36418822	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	25148511		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	32913257, 8196285	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	20118187, 20623750, 22005293, 23052191, 24361871, 28885000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	31296157		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	29511890		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	16675913	Stimulate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	15467709	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15345285	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	30291488		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	35729600	Associate	★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	15304052		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15791650, 19264665, 19413638, 21419759, 22949882, 23010347, 23457489, 25600802, 25609201, 26217078, 28881732, 29229391, 29436591, 29721050, 29731881, 31232234, 31567651, 31800534		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19413638, 29427759		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15791650, 25600802		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	29382921	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases Obstructive	Lung disease	Pubtator	35191419	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17855704		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24751980, 28954633, 31622403, 31854219	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15304052	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12753656, 15304052, 19502269, 20300756, 20442749, 28390925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15304052		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	15304052		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	19502269, 20300756		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17121433, 32039450	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22799602	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10887098		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	19220628	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	12391305, 17148042, 34406330	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	BEFREE	7526972		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15685647, 16373699, 17689225, 17722531, 18078515, 18508997, 19903745, 20307318, 22037783, 22369881, 22613415, 23099883, 23174100, 25144344, 28890185, 31273033, 31428526, 8252481		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22211095		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	11571636, 24008723		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29478368		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15026542, 15770517, 19879423, 21630085, 23276503, 28294391, 28954633, 29686328		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15578711, 19391138, 22185350, 23208459, 26293319, 31540420		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12370533, 22967941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10646846, 10646870, 10811138, 10815883, 11502446, 11504787, 11571636, 11813210, 12370533, 12374699, 12409141, 12579291, 14618611, 15033782, 15174974, 15358631, 15389725, 15713890, 15770517, 16201973, 16211311, 16879694, 17148459, 17224269, 18649357, 18974881, 19137541, 19879420, 21732348, 21987172, 22689054, 23130925, 23621580, 23838317, 24491388, 24599003, 25343293, 25503391, 26106075, 27198502, 27978767, 29463595, 29665645, 30305646, 30720069		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17148459		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22773549, 30745823		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	24217652		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25934174		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11751526, 15126879, 15802022, 15809754, 22895628, 31114318		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10084304, 11956479, 12200037, 12679903, 12882985, 14618611, 15530543, 15578711, 15685647, 16179938, 17048076, 17322305, 18514801, 19012510, 19166932, 19342222, 19353783, 19879427, 19903745, 19940549, 20940405, 21987172, 22185350, 22689054, 22895628, 22896337, 23276503, 23457489, 24085287, 25503391, 25934174, 26988917, 27781946, 27978767, 28064403, 28471806, 28687930, 28890185, 28925903, 29400663, 29965900, 30565691, 31114318, 31428526, 31433751		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	24217652		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18177691		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15492264, 18055195, 18180384, 19177010, 19879422, 24085798, 25917404, 26399194		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15685647, 19940549, 8252481		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	33299887	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	26153655		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28411179		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15675962	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	15955107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	15955107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	15955107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	16886681, 22157936, 28623268	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	16886681	Associate	★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	LHGDN	16775601		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	28233427	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	23111736	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23209684		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	33804147	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	32764517, 40243895	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28958138		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	20482488		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	22896337		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	24117116, 24388797, 25189118, 26159191, 26976043, 27229352, 27237222, 30291488, 30445127, 30503753, 30560405		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	CTD_human_DG	30503753		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19118032	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	28707765	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	28843803		★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	28843803		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidoses	Mucopolysaccharidosis	Pubtator	32366041	Associate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis IV	Mucopolysaccharidosis	Pubtator	34200496	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23762311	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26683597		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	33299887	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35007303	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28948410, 28958138, 29891738, 31406108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	32389013	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	28948410		★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	Pubtator	15912881	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	15912881	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	33506054	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26716898		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10646846, 10646870, 10811138, 10887098, 10934144, 11085517, 11502446, 11504787, 11571636, 11751526, 12374699, 14618611, 14996747, 15026542, 15126350, 15126879, 15358631, 15578711, 15713890, 15802022, 15929184, 15955107, 16179938, 16373699, 16675913, 16879694, 16954163, 18079682, 18709641, 18974881, 19391138, 19401549, 19879423, 19903339, 19903745, 19940549, 20307318, 21732348, 21737488, 21761117, 22068036, 22185350, 22613415, 22967941, 23051594, 23099883, 23208459, 23362253, 23457489, 23786771, 24156019, 24217652, 24969394, 25391657, 26716898, 26753958, 26988917, 28076321, 28890185, 28902909, 29400663, 29420353, 30470719, 30745823, 30967152, 31567651, 31672651, 31800534, 8252481		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	12427144		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	20420693, 22617144		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10770937, 12882985, 16464517, 19401549, 20096688, 21042904, 22012253, 22082661, 25411798, 25505154		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21042904	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	17148042, 1924317, 24073260, 24806679, 26179372, 26545630	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	1924317, 19353783, 22082661, 22617144, 25434681, 26179372, 26683597, 28687930, 29115989, 8181474		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	29420353		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	31708932		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	26343804		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21630085, 24943969, 28954633, 29253572		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29229391		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	10934144		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20847305	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28120874, 30659075		★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	30426189		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	22902018		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11795992, 32516132, 40243895	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	25287745, 30967152, 32832544, 37033956	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	29717106, 30053814	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Hip	Osteoarthritis	Pubtator	31352363	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	32917098	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	17568789, 18784066		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30967152		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	30967152	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	35456459	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	14996747, 17096323, 23063503, 25025927, 31433751		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15578711, 23208459		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	21761117	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19391138, 22185350, 23208459, 26293319, 31540420		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15578711, 18714397, 19487548, 21761117, 22185350, 26293319	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23579955	Stimulate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	11502446, 11504787, 12374699, 15713890		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12370533, 22967941		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	12370533		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22799602, 22967941, 36694355	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	27939882		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	12370533		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	19165232		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma	Papilloma	BEFREE	11085517, 15126350		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21912625, 23820587, 29067960		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21912625, 37328865	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31593110, 37479568	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	15974849		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	29610270	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	20149216, 23649770		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	22092770	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	16436671	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	26753958	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	35008095	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	22082661		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	19734902, 19734903, 21460841		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	24806679, 29067960, 29534716, 29698690, 30291488, 30791945, 9878186		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	26159191		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10646846, 10646870, 10811138, 10815883, 11502446, 11504787, 11571636, 11813210, 12374699, 12409141, 12579291, 14618611, 15033782, 15174974, 15358631, 15389725, 15713890, 15770517, 16201973, 16211311, 16879694, 17148459, 17224269, 18649357, 18974881, 19137541, 19879420, 21732348, 21987172, 22689054, 23130925, 23621580, 23838317, 24491388, 24599003, 25343293, 25503391, 26106075, 27198502, 27978767, 29463595, 29665645, 30305646		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	30560838	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	19597465		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11813210, 15033782, 15389725, 17224269, 18649357, 19137541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15494717, 20068069, 20643827, 21987172, 23418433, 25967040, 27198502, 30305646	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17148459		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18025278, 19935703, 31426412, 8549673		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	30560838		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28958138		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	33804147	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	19956562		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35191419	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29382921		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	29382921	Inhibit	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11571636, 11714447, 11956479, 18079682, 23670677, 24008723, 27526062, 29400663		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	11714447		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	25148511		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28979697		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	1555655, 28767729, 8181474, 8302166, 8302167		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	1555655	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	24085287		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	20420693		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	20420693	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17056579, 17568789, 22166956, 26314337		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17056579		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	26732727	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	23063503		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	30967152	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20738160, 26482819, 30599442		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20738160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	31545397	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	21647955	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	24217652		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	24217652	Inhibit	★☆☆☆☆ Found in Text Mining only
Senile cardiac amyloidosis	Senile Cardiac Amyloidosis	BEFREE	19664600		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	9878186		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	10934144	Stimulate	★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	23266720		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	30876376		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31708932	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28958138		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	11085517		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28117613		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11085517, 15126350, 16675913		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12679903, 15133840		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12679903, 15133840		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16675913, 18254958, 24327270	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28954633		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24327270		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29229391		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22773549, 30745823		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36253534	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28803177		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	22166956		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	1331774		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	24217652	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33521130, 34767591	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25934174		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25934174, 28411179		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25934174	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	25934174		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	23266720		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22310975, 28890185		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23917248		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19757199	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22159600	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20058210, 21633299	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29534716		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	24758255	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	36291126	Inhibit	★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	23266720		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	18079682		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	LHGDN	18079682		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	8196285	Stimulate	★☆☆☆☆ Found in Text Mining only