Gene Gene information from NCBI Gene database.
Entrez ID 118924
Gene name FRA10A associated CGG repeat 1
Gene symbol FRA10AC1
Synonyms (NCBI Gene)
C10orf4F26C11.1-likeFRA10ANEDGFC
Chromosome 10
Chromosome location 10q23.33
Summary The protein encoded by this gene is a nuclear phosphoprotein of unknown function. This gene contains a tandem CGG repeat region within a CpG island that normally consists of 8-14 repeats but can expand to over 200 repeats. The repeat region is within the
miRNA miRNA information provided by mirtarbase database.
199
miRTarBase ID miRNA Experiments Reference
MIRT022031 hsa-miR-128-3p Microarray 17612493
MIRT025142 hsa-miR-181a-5p Microarray 17612493
MIRT1003975 hsa-miR-1228 CLIP-seq
MIRT1003976 hsa-miR-1238 CLIP-seq
MIRT1003977 hsa-miR-1252 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IMP 34694367
GO:0005515 Function Protein binding IPI 16169070, 22365833, 25416956, 31515488, 32296183, 33961781, 34694367
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus IMP 34694367
GO:0016791 Function Phosphatase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608866 1162 ENSG00000148690
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q70Z53
Protein name Protein FRA10AC1
Protein function May be involved in pre-mRNA splicing.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09725 Fra10Ac1 104 220 Folate-sensitive fragile site protein Fra10Ac1 Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed with higher expression in brain, heart, skeletal muscle, kidney and liver. {ECO:0000269|PubMed:15203205}.
Sequence
MHGHGGYDSDFSDDERCGESSKRKKRTVEDDLLLQKPFQKEKHGKVAHKQVAAELLDREE
ARNRRFHLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGENDKTDLDVIRENHRFLWNEE
DEMDMTWEKRLAKKYYDKLFKEYCIADLSKYKENKFGFRWRVEKEVISGKGQFFCGNKYC
DKKEGLKSWEVNFGYIEHGEKRNALVKLRLCQECSIKLNF
HHRRKEIKSKKRKDKTKKDC
EESSHKKSRLSSAEEASKKKDKGHSSSKKSEDSLLRNSDEEESASESELWKGPLPETDEK
SQEEEFDEYFQDLFL
Sequence length 315
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Acute myeloid leukemia Pathogenic rs199549545 RCV005931776
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder with growth retardation, dysmorphic facies, and corpus callosum abnormalities Pathogenic; Likely pathogenic rs2492662538, rs1427003828, rs555127846, rs199549545, rs764976937, rs2492694754 RCV002305683
RCV002305684
RCV002305685
RCV002305687
RCV003479931
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Developmental Disabilities Developmental disability Pubtator 34694367 Associate
★☆☆☆☆
Found in Text Mining only
Growth Disorders Growth disorder Pubtator 34694367 Associate
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Intellectual developmental disorder Pubtator 34694367 Associate
★☆☆☆☆
Found in Text Mining only
Microcephaly Microcephaly Pubtator 34694367 Associate
★☆☆☆☆
Found in Text Mining only