C10orf90 (chromosome 10 open reading frame 90)

Gene

• Entrez ID: 118611
• Gene name: Chromosome 10 open reading frame 90
• Gene symbol: C10orf90
• Synonyms (NCBI Gene): FATS, bA422P15.2
• Chromosome: 10
• Chromosome location: 10q26.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT829322	hsa-miR-1280	CLIP-seq
MIRT829323	hsa-miR-1825	CLIP-seq
MIRT829324	hsa-miR-199a-5p	CLIP-seq
MIRT829325	hsa-miR-199b-5p	CLIP-seq
MIRT829326	hsa-miR-2355-5p	CLIP-seq
MIRT829327	hsa-miR-3679-3p	CLIP-seq
MIRT829328	hsa-miR-3689d	CLIP-seq
MIRT829329	hsa-miR-3691-3p	CLIP-seq
MIRT829330	hsa-miR-3713	CLIP-seq
MIRT829331	hsa-miR-4286	CLIP-seq
MIRT829332	hsa-miR-4666-5p	CLIP-seq
MIRT829333	hsa-miR-4802-3p	CLIP-seq
MIRT829334	hsa-miR-4802-5p	CLIP-seq
MIRT829335	hsa-miR-876-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	20844083
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	20844083
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IBA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	IDA	20844083
GO:0016567	Process	Protein ubiquitination	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0046599	Process	Regulation of centriole replication	IBA
GO:0050821	Process	Protein stabilization	ISS
GO:0061630	Function	Ubiquitin protein ligase activity	ISS

Other IDs

• MIM: 617735
• HGNC: 26563
• e!Ensembl: ENSG00000154493

Protein

• UniProt ID: Q96M02
• Protein name: (E2-independent) E3 ubiquitin-conjugating enzyme FATS (EC 2.3.2.-) (Centrosomal protein C10orf90) (E2/E3 hybrid ubiquitin-protein ligase FATS) (Fragile-site associated tumor suppressor homolog) (FATS)
• Protein function: Tumor suppressor that is required to sustain G2/M checkpoint after DNA damage. Acts as a p53/TP53 activator by inhibiting MDM2 binding to p53/TP53 and stimulating non-proteolytic polyubiquitination of p53/TP53. Exhibits ubiquitin ligase (E3) act
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17730	Centro_C10orf90	52 → 563	Centrosomal C10orf90	Family
  PF15309	ALMS_motif	567 → 697	ALMS motif	Family

• Sequence:

  MLKLSGEGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDE
  NKSRENRASLPLPCAIAQSRAHHAKQSLANRSGVNIHRAFALLPGRLGIPAPSDERGPEA
  ELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPAL
  ANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPL
  SGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHR
  LTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGAC
  PWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVF
  SGSSKRQQGEVCMTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRHQSFLKPR
  ILFPGFLCPLQDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA
  APSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQ
  RKAQRKEDLRQKQSLLPIRTSKKQFTIPHPLSDNLFKPKERCISEKEMHMRSKRIYDNLP
  EVKKKKEEQRKRVILQSNRLRAEVFKKQLLDQLLQRNAV

• Sequence length: 699

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	22040499, 26223354, 28402275		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26223354, 28402275	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26223354, 28402275	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	39408824	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	20154723		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22040499, 26223354, 28402275		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30672666	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22040499, 22137560, 28402275, 30672666		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22137560		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	27515689		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	39408824	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASDB_DG	21926974		★☆☆☆☆ Found in Text Mining only