Gene Gene information from NCBI Gene database.
Entrez ID 1180
Gene name Chloride voltage-gated channel 1
Gene symbol CLCN1
Synonyms (NCBI Gene)
CLC1
Chromosome 7
Chromosome location 7q34
Summary The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. The protein encoded by this gene regulates the
SNPs SNP information provided by dbSNP.
123
SNP ID Visualize variation Clinical significance Consequence
rs55960271 C>A,T Pathogenic, likely-pathogenic Non coding transcript variant, stop gained, synonymous variant, coding sequence variant
rs80356684 A>T Pathogenic Non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs80356685 C>G Uncertain-significance, pathogenic, likely-pathogenic Non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs80356686 G>A Pathogenic Non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs80356687 C>T Pathogenic-likely-pathogenic, pathogenic Missense variant, intron variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0005247 Function Voltage-gated chloride channel activity IBA
GO:0005247 Function Voltage-gated chloride channel activity IEA
GO:0005247 Function Voltage-gated chloride channel activity IMP 22521272, 26007199, 26502825
GO:0005254 Function Chloride channel activity IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
118425 2019 ENSG00000188037
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P35523
Protein name Chloride channel protein 1 (ClC-1) (Chloride channel protein, skeletal muscle)
Protein function Voltage-gated chloride channel involved in skeletal muscle excitability. Generates most of the plasma membrane chloride conductance in skeletal muscle fibers, stabilizes the resting membrane potential and contributes to the repolarization phase
PDB 6COY , 6COZ , 6QV6 , 6QVB , 6QVC , 6QVD , 6QVU , 8WXI , 8WXJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00654 Voltage_CLC 170 572 Voltage gated chloride channel Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in skeletal muscles.
Sequence
MEQSRSQQRGGEQSWWGSDPQYQYMPFEHCTSYGLPSENGGLQHRLRKDAGPRHNVHPTQ
IYGHHKEQFSDREQDIGMPKKTGSSSTVDSKDEDHYSKCQDCIHRLGQVVRRKLGEDGIF
LVLLGLLMALVSWSMDYVSAKSLQAYKWSYAQMQPSLPLQFLVWVTFPLVLILFSALFCH
LISPQAVGSGIPEMKTILRGVVLKEYLTMKAFVAKVVALTAGLGSGIPVGKEGPFVHIAS
ICAAVLSKFMSVFCGVYEQPYYYSDILTVGCAVGVGCCFGTPLGGVLFSIEVTSTYFAVR
NYWRGFFAATFSAFVFRVLAVWNKDAVTITALFRTNFRMDFPFDLKELPAFAAIGICCGL
LGAVFVYLHRQVMLGVRKHKALSQFLAKHRLLYPGIVTFVIASFTFPPGMGQFMAGELMP
REAISTLFDNNTWVKHAGDPESLGQSAVWIHPRVNVVIIIFLFFVMKFWMSIVATTMPIP
CGGFMPVFVLGAAFGRLVGEIMAMLFPDGILFDDIIYKILPGGYAVIGAAALTGAVSHTV
STAVICFELTGQIAHILPMMVAVILANMVAQS
LQPSLYDSIIQVKKLPYLPDLGWNQLSK
YTIFVEDIMVRDVKFVSASYTYGELRTLLQTTTVKTLPLVDSKDSMILLGSVERSELQAL
LQRHLCPERRLRAAQEMARKLSELPYDGKARLAGEGLPGAPPGRPESFAFVDEDEDEDLS
GKSELPPSLALHPSTTAPLSPEEPNGPLPGHKQQPEAPEPAGQRPSIFQSLLHCLLGRAR
PTKKKTTQDSTDLVDNMSPEEIEAWEQEQLSQPVCFDSCCIDQSPFQLVEQTTLHKTHTL
FSLLGLHLAYVTSMGKLRGVLALEELQKAIEGHTKSGVQLRPPLASFRNTTSTRKSTGAP
PSSAENWNLPEDRPGATGTGDVIAASPETPVPSPSPEPPLSLAPGKVEGELEELELVESP
GLEEELADILQGPSLRSTDEEDEDELIL
Sequence length 988
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Stimuli-sensing channels
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
37
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormality of the musculature Likely pathogenic; Pathogenic rs55960271, rs770605959 RCV001813999
RCV001836882
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Achilles tendon contracture Likely pathogenic rs1554438441 RCV000626581
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autosomal dominant intermediate Charcot-Marie-Tooth disease Likely pathogenic; Pathogenic rs768119034 RCV000664241
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Batten-Turner congenital myopathy Likely pathogenic; Pathogenic rs139158852, rs762754992, rs776073429, rs146457619, rs768119034, rs80356700, rs80356694, rs80356696, rs80356690, rs80356702, rs55960271, rs80356699, rs80356704, rs80356701, rs80356691
View all (1 more)
RCV001837017
RCV000194136
RCV000305146
RCV000778823
RCV000778142
View all (11 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BECKER GENERALIZED MYOTONIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Dystonia, early-onset, and/or spastic paraplegia Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
EMG: myotonic discharges Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Andersen Syndrome Andersen-tawil syndrome Pubtator 23516313 Associate
★☆☆☆☆
Found in Text Mining only
Andersen Syndrome Andersen Syndrome BEFREE 25188014
★☆☆☆☆
Found in Text Mining only
Arrhythmias Cardiac Cardiac arrhythmias Pubtator 33263785 Associate
★☆☆☆☆
Found in Text Mining only
Becker Generalized Myotonia Congenital myotonia CLINVAR_DG 10051520, 10430417, 10644771, 10665666, 10690989, 10737121, 10962018, 11408615, 11840191, 12390967, 12456818, 12661046, 1379744, 15162127, 15311340
View all (71 more)
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Becker Generalized Myotonia Congenital myotonia BEFREE 10215406, 10619717, 10737121, 15116370, 16854622, 22649220, 23152584, 23933576, 24349310, 24452722, 26007199, 27300293, 30243293, 7951242, 8857733
View all (1 more)
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Becker Generalized Myotonia Congenital myotonia UNIPROT_DG 10215406, 10644771, 11113225, 12661046, 1379744, 19697366, 22521272, 22641783, 26007199, 26096614, 26502825, 26510092, 7874130, 7951242, 7981681
View all (5 more)
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Becker Generalized Myotonia Congenital myotonia GENOMICS_ENGLAND_DG 17932099, 22649220
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Becker Generalized Myotonia Congenital myotonia CTD_human_DG 20399394
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Becker Muscular Dystrophy Becker Muscular Dystrophy BEFREE 24349310, 26007199, 27300293, 30243293, 7951242
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Cognition disorder Pubtator 29851785 Associate
★☆☆☆☆
Found in Text Mining only