ADD1 (adducin 1)

Gene

• Entrez ID: 118
• Gene name: Adducin 1
• Gene symbol: ADD1
• Synonyms (NCBI Gene): ADDA
• Chromosome: 4
• Chromosome location: 4p16.3
• Summary: Adducins are a family of cytoskeletal proteins encoded by three genes (alpha, beta, and gamma). Adducin acts as a heterodimer of the related alpha, beta, or gamma subunits. The protein encoded by this gene represents the alpha subunit. Alpha- and beta-add

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs4961	G>A,T	Risk-factor, drug-response	Coding sequence variant, missense variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030434	hsa-miR-24-3p	Microarray	19748357
MIRT046898	hsa-miR-221-3p	CLASH	23622248
MIRT644229	hsa-miR-543	HITS-CLIP	23824327
MIRT644228	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT644227	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT644226	hsa-miR-1248	HITS-CLIP	23824327
MIRT644225	hsa-miR-520f-5p	HITS-CLIP	23824327
MIRT644224	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT644223	hsa-miR-27a-5p	HITS-CLIP	23824327
MIRT644222	hsa-miR-3143	HITS-CLIP	23824327
MIRT644221	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT644220	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT644219	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT644218	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT644217	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT093744	hsa-miR-27a-3p	PAR-CLIP	24398324
MIRT093745	hsa-miR-27b-3p	PAR-CLIP	24398324
MIRT503187	hsa-miR-128-3p	PAR-CLIP	24398324
MIRT503186	hsa-miR-216a-3p	PAR-CLIP	24398324
MIRT503185	hsa-miR-3681-3p	PAR-CLIP	24398324
MIRT093746	hsa-miR-513a-5p	PAR-CLIP	24398324
MIRT164727	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT164720	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT164727	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT164719	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT164735	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT164721	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT164744	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT164720	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT644229	hsa-miR-543	HITS-CLIP	23824327
MIRT644228	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT644227	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT644226	hsa-miR-1248	HITS-CLIP	23824327
MIRT644225	hsa-miR-520f-5p	HITS-CLIP	23824327
MIRT644224	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT644223	hsa-miR-27a-5p	HITS-CLIP	23824327
MIRT644222	hsa-miR-3143	HITS-CLIP	23824327
MIRT644221	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT644220	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT644219	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT644218	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT644217	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT093744	hsa-miR-27a-3p	PAR-CLIP	24398324
MIRT093745	hsa-miR-27b-3p	PAR-CLIP	24398324
MIRT503187	hsa-miR-128-3p	PAR-CLIP	24398324
MIRT503186	hsa-miR-216a-3p	PAR-CLIP	24398324
MIRT503185	hsa-miR-3681-3p	PAR-CLIP	24398324
MIRT093746	hsa-miR-513a-5p	PAR-CLIP	24398324
MIRT768458	hsa-miR-1204	CLIP-seq
MIRT768459	hsa-miR-128	CLIP-seq
MIRT768460	hsa-miR-129-5p	CLIP-seq
MIRT768461	hsa-miR-1298	CLIP-seq
MIRT768462	hsa-miR-149	CLIP-seq
MIRT768463	hsa-miR-18a	CLIP-seq
MIRT768464	hsa-miR-18b	CLIP-seq
MIRT768465	hsa-miR-27a	CLIP-seq
MIRT768466	hsa-miR-27b	CLIP-seq
MIRT768467	hsa-miR-3064-3p	CLIP-seq
MIRT768468	hsa-miR-3064-5p	CLIP-seq
MIRT768469	hsa-miR-30a	CLIP-seq
MIRT768470	hsa-miR-30b	CLIP-seq
MIRT768471	hsa-miR-30c	CLIP-seq
MIRT768472	hsa-miR-30d	CLIP-seq
MIRT768473	hsa-miR-30e	CLIP-seq
MIRT768474	hsa-miR-3119	CLIP-seq
MIRT768475	hsa-miR-3123	CLIP-seq
MIRT768476	hsa-miR-3144-5p	CLIP-seq
MIRT768477	hsa-miR-3152-3p	CLIP-seq
MIRT768478	hsa-miR-3158-3p	CLIP-seq
MIRT768479	hsa-miR-3184	CLIP-seq
MIRT768480	hsa-miR-3191	CLIP-seq
MIRT768481	hsa-miR-33a	CLIP-seq
MIRT768482	hsa-miR-33b	CLIP-seq
MIRT768483	hsa-miR-3649	CLIP-seq
MIRT768484	hsa-miR-3687	CLIP-seq
MIRT768485	hsa-miR-3940-3p	CLIP-seq
MIRT768486	hsa-miR-3941	CLIP-seq
MIRT768487	hsa-miR-423-5p	CLIP-seq
MIRT768488	hsa-miR-4271	CLIP-seq
MIRT768489	hsa-miR-4294	CLIP-seq
MIRT768490	hsa-miR-4420	CLIP-seq
MIRT768491	hsa-miR-4424	CLIP-seq
MIRT768492	hsa-miR-4433	CLIP-seq
MIRT768493	hsa-miR-4436a	CLIP-seq
MIRT768494	hsa-miR-4436b-3p	CLIP-seq
MIRT768495	hsa-miR-4442	CLIP-seq
MIRT768496	hsa-miR-4444	CLIP-seq
MIRT768497	hsa-miR-4457	CLIP-seq
MIRT768498	hsa-miR-4468	CLIP-seq
MIRT768499	hsa-miR-4477b	CLIP-seq
MIRT768500	hsa-miR-4489	CLIP-seq
MIRT768501	hsa-miR-4492	CLIP-seq
MIRT768502	hsa-miR-4498	CLIP-seq
MIRT768503	hsa-miR-4508	CLIP-seq
MIRT768504	hsa-miR-450b-5p	CLIP-seq
MIRT768505	hsa-miR-4532	CLIP-seq
MIRT768506	hsa-miR-466	CLIP-seq
MIRT768507	hsa-miR-4672	CLIP-seq
MIRT768508	hsa-miR-4682	CLIP-seq
MIRT768509	hsa-miR-4690-3p	CLIP-seq
MIRT768510	hsa-miR-4700-3p	CLIP-seq
MIRT768511	hsa-miR-4725-3p	CLIP-seq
MIRT768512	hsa-miR-4727-5p	CLIP-seq
MIRT768513	hsa-miR-4731-3p	CLIP-seq
MIRT768514	hsa-miR-4735-3p	CLIP-seq
MIRT768515	hsa-miR-4743	CLIP-seq
MIRT768516	hsa-miR-4761-3p	CLIP-seq
MIRT768517	hsa-miR-4786-3p	CLIP-seq
MIRT768518	hsa-miR-4794	CLIP-seq
MIRT768519	hsa-miR-4801	CLIP-seq
MIRT768520	hsa-miR-507	CLIP-seq
MIRT768521	hsa-miR-513b	CLIP-seq
MIRT768522	hsa-miR-557	CLIP-seq
MIRT768523	hsa-miR-602	CLIP-seq
MIRT768524	hsa-miR-645	CLIP-seq
MIRT768525	hsa-miR-665	CLIP-seq
MIRT768526	hsa-miR-671-5p	CLIP-seq
MIRT768527	hsa-miR-762	CLIP-seq
MIRT768528	hsa-miR-885-5p	CLIP-seq
MIRT768529	hsa-miR-1915	CLIP-seq
MIRT768530	hsa-miR-2909	CLIP-seq
MIRT768531	hsa-miR-2964a-5p	CLIP-seq
MIRT768532	hsa-miR-296-5p	CLIP-seq
MIRT768479	hsa-miR-3184	CLIP-seq
MIRT768533	hsa-miR-3622a-3p	CLIP-seq
MIRT768534	hsa-miR-3622b-3p	CLIP-seq
MIRT768535	hsa-miR-3672	CLIP-seq
MIRT768487	hsa-miR-423-5p	CLIP-seq
MIRT768488	hsa-miR-4271	CLIP-seq
MIRT768536	hsa-miR-4324	CLIP-seq
MIRT768537	hsa-miR-4329	CLIP-seq
MIRT768538	hsa-miR-4685-5p	CLIP-seq
MIRT768511	hsa-miR-4725-3p	CLIP-seq
MIRT768517	hsa-miR-4786-3p	CLIP-seq
MIRT768526	hsa-miR-671-5p	CLIP-seq
MIRT768460	hsa-miR-129-5p	CLIP-seq
MIRT768474	hsa-miR-3119	CLIP-seq
MIRT1545143	hsa-miR-3140-5p	CLIP-seq
MIRT768476	hsa-miR-3144-5p	CLIP-seq
MIRT768478	hsa-miR-3158-3p	CLIP-seq
MIRT768481	hsa-miR-33a	CLIP-seq
MIRT768482	hsa-miR-33b	CLIP-seq
MIRT768483	hsa-miR-3649	CLIP-seq
MIRT768486	hsa-miR-3941	CLIP-seq
MIRT768497	hsa-miR-4457	CLIP-seq
MIRT768504	hsa-miR-450b-5p	CLIP-seq
MIRT768506	hsa-miR-466	CLIP-seq
MIRT768507	hsa-miR-4672	CLIP-seq
MIRT1545144	hsa-miR-4721	CLIP-seq
MIRT768513	hsa-miR-4731-3p	CLIP-seq
MIRT768519	hsa-miR-4801	CLIP-seq
MIRT768520	hsa-miR-507	CLIP-seq
MIRT768522	hsa-miR-557	CLIP-seq
MIRT768524	hsa-miR-645	CLIP-seq
MIRT1545145	hsa-miR-658	CLIP-seq
MIRT768528	hsa-miR-885-5p	CLIP-seq
MIRT768537	hsa-miR-4329	CLIP-seq
MIRT1926684	hsa-miR-4459	CLIP-seq
MIRT768537	hsa-miR-4329	CLIP-seq
MIRT1926684	hsa-miR-4459	CLIP-seq
MIRT2167611	hsa-miR-103a	CLIP-seq
MIRT2167612	hsa-miR-107	CLIP-seq
MIRT2167613	hsa-miR-1291	CLIP-seq
MIRT2167614	hsa-miR-153	CLIP-seq
MIRT2167615	hsa-miR-24	CLIP-seq
MIRT2167616	hsa-miR-2467-5p	CLIP-seq
MIRT768467	hsa-miR-3064-3p	CLIP-seq
MIRT2167617	hsa-miR-3125	CLIP-seq
MIRT2167618	hsa-miR-3173-5p	CLIP-seq
MIRT2167619	hsa-miR-3188	CLIP-seq
MIRT2167620	hsa-miR-320e	CLIP-seq
MIRT2167621	hsa-miR-361-3p	CLIP-seq
MIRT768533	hsa-miR-3622a-3p	CLIP-seq
MIRT768534	hsa-miR-3622b-3p	CLIP-seq
MIRT768535	hsa-miR-3672	CLIP-seq
MIRT2167622	hsa-miR-3916	CLIP-seq
MIRT2167623	hsa-miR-3921	CLIP-seq
MIRT2167624	hsa-miR-3926	CLIP-seq
MIRT768486	hsa-miR-3941	CLIP-seq
MIRT2167625	hsa-miR-3975	CLIP-seq
MIRT2167626	hsa-miR-4251	CLIP-seq
MIRT2167627	hsa-miR-4257	CLIP-seq
MIRT768489	hsa-miR-4294	CLIP-seq
MIRT768536	hsa-miR-4324	CLIP-seq
MIRT768537	hsa-miR-4329	CLIP-seq
MIRT768492	hsa-miR-4433	CLIP-seq
MIRT768497	hsa-miR-4457	CLIP-seq
MIRT2167628	hsa-miR-450b-3p	CLIP-seq
MIRT2167629	hsa-miR-4638-5p	CLIP-seq
MIRT2167630	hsa-miR-4649-3p	CLIP-seq
MIRT2167631	hsa-miR-4653-5p	CLIP-seq
MIRT2167632	hsa-miR-4654	CLIP-seq
MIRT768506	hsa-miR-466	CLIP-seq
MIRT768507	hsa-miR-4672	CLIP-seq
MIRT768508	hsa-miR-4682	CLIP-seq
MIRT2167633	hsa-miR-4713-3p	CLIP-seq
MIRT768513	hsa-miR-4731-3p	CLIP-seq
MIRT2167634	hsa-miR-4769-5p	CLIP-seq
MIRT768517	hsa-miR-4786-3p	CLIP-seq
MIRT768519	hsa-miR-4801	CLIP-seq
MIRT2167635	hsa-miR-485-5p	CLIP-seq
MIRT2167636	hsa-miR-548s	CLIP-seq
MIRT2167637	hsa-miR-638	CLIP-seq
MIRT768525	hsa-miR-665	CLIP-seq
MIRT768526	hsa-miR-671-5p	CLIP-seq
MIRT2167638	hsa-miR-720	CLIP-seq
MIRT2167639	hsa-miR-760	CLIP-seq
MIRT2167640	hsa-miR-769-3p	CLIP-seq
MIRT2383927	hsa-miR-3151	CLIP-seq
MIRT2383928	hsa-miR-342-5p	CLIP-seq
MIRT2383929	hsa-miR-4283	CLIP-seq
MIRT768500	hsa-miR-4489	CLIP-seq
MIRT2383930	hsa-miR-4651	CLIP-seq
MIRT2383931	hsa-miR-4663	CLIP-seq
MIRT2383932	hsa-miR-4664-5p	CLIP-seq
MIRT2383933	hsa-miR-608	CLIP-seq
MIRT768459	hsa-miR-128	CLIP-seq
MIRT768465	hsa-miR-27a	CLIP-seq
MIRT768466	hsa-miR-27b	CLIP-seq
MIRT768467	hsa-miR-3064-3p	CLIP-seq
MIRT2426022	hsa-miR-3978	CLIP-seq
MIRT768489	hsa-miR-4294	CLIP-seq
MIRT768492	hsa-miR-4433	CLIP-seq
MIRT768508	hsa-miR-4682	CLIP-seq
MIRT768517	hsa-miR-4786-3p	CLIP-seq
MIRT2426023	hsa-miR-548p	CLIP-seq
MIRT768525	hsa-miR-665	CLIP-seq
MIRT768530	hsa-miR-2909	CLIP-seq
MIRT768467	hsa-miR-3064-3p	CLIP-seq
MIRT768533	hsa-miR-3622a-3p	CLIP-seq
MIRT768534	hsa-miR-3622b-3p	CLIP-seq
MIRT768535	hsa-miR-3672	CLIP-seq
MIRT768489	hsa-miR-4294	CLIP-seq
MIRT768536	hsa-miR-4324	CLIP-seq
MIRT768537	hsa-miR-4329	CLIP-seq
MIRT768492	hsa-miR-4433	CLIP-seq
MIRT768508	hsa-miR-4682	CLIP-seq
MIRT768517	hsa-miR-4786-3p	CLIP-seq
MIRT768525	hsa-miR-665	CLIP-seq
MIRT768461	hsa-miR-1298	CLIP-seq
MIRT2167616	hsa-miR-2467-5p	CLIP-seq
MIRT2167619	hsa-miR-3188	CLIP-seq
MIRT2167621	hsa-miR-361-3p	CLIP-seq
MIRT2167623	hsa-miR-3921	CLIP-seq
MIRT2167625	hsa-miR-3975	CLIP-seq
MIRT2443250	hsa-miR-4312	CLIP-seq
MIRT768499	hsa-miR-4477b	CLIP-seq
MIRT2167630	hsa-miR-4649-3p	CLIP-seq
MIRT2167631	hsa-miR-4653-5p	CLIP-seq
MIRT768512	hsa-miR-4727-5p	CLIP-seq
MIRT2167635	hsa-miR-485-5p	CLIP-seq
MIRT2167639	hsa-miR-760	CLIP-seq
MIRT2470181	hsa-miR-1225-3p	CLIP-seq
MIRT2470182	hsa-miR-1226	CLIP-seq
MIRT2470183	hsa-miR-1233	CLIP-seq
MIRT2470184	hsa-miR-1263	CLIP-seq
MIRT2470185	hsa-miR-129-3p	CLIP-seq
MIRT2470186	hsa-miR-1470	CLIP-seq
MIRT2470187	hsa-miR-203	CLIP-seq
MIRT2470188	hsa-miR-214	CLIP-seq
MIRT2167615	hsa-miR-24	CLIP-seq
MIRT2167616	hsa-miR-2467-5p	CLIP-seq
MIRT2470189	hsa-miR-2861	CLIP-seq
MIRT768530	hsa-miR-2909	CLIP-seq
MIRT768532	hsa-miR-296-5p	CLIP-seq
MIRT768467	hsa-miR-3064-3p	CLIP-seq
MIRT2470190	hsa-miR-3126-5p	CLIP-seq
MIRT1545143	hsa-miR-3140-5p	CLIP-seq
MIRT2470191	hsa-miR-3147	CLIP-seq
MIRT2470192	hsa-miR-3155	CLIP-seq
MIRT2470193	hsa-miR-3155b	CLIP-seq
MIRT2167619	hsa-miR-3188	CLIP-seq
MIRT2470194	hsa-miR-3619-5p	CLIP-seq
MIRT2470195	hsa-miR-3620	CLIP-seq
MIRT768533	hsa-miR-3622a-3p	CLIP-seq
MIRT768534	hsa-miR-3622b-3p	CLIP-seq
MIRT2470196	hsa-miR-3663-5p	CLIP-seq
MIRT2470197	hsa-miR-3664-3p	CLIP-seq
MIRT2470198	hsa-miR-3670	CLIP-seq
MIRT768535	hsa-miR-3672	CLIP-seq
MIRT2470199	hsa-miR-370	CLIP-seq
MIRT2470200	hsa-miR-3920	CLIP-seq
MIRT2167623	hsa-miR-3921	CLIP-seq
MIRT2167625	hsa-miR-3975	CLIP-seq
MIRT2470201	hsa-miR-4267	CLIP-seq
MIRT768488	hsa-miR-4271	CLIP-seq
MIRT2470202	hsa-miR-4291	CLIP-seq
MIRT768489	hsa-miR-4294	CLIP-seq
MIRT2470203	hsa-miR-4303	CLIP-seq
MIRT2470204	hsa-miR-4316	CLIP-seq
MIRT768536	hsa-miR-4324	CLIP-seq
MIRT768537	hsa-miR-4329	CLIP-seq
MIRT2470205	hsa-miR-4425	CLIP-seq
MIRT768492	hsa-miR-4433	CLIP-seq
MIRT1926684	hsa-miR-4459	CLIP-seq
MIRT2470206	hsa-miR-4506	CLIP-seq
MIRT2470207	hsa-miR-4512	CLIP-seq
MIRT2167631	hsa-miR-4653-5p	CLIP-seq
MIRT2470208	hsa-miR-4660	CLIP-seq
MIRT768508	hsa-miR-4682	CLIP-seq
MIRT2470209	hsa-miR-4710	CLIP-seq
MIRT768511	hsa-miR-4725-3p	CLIP-seq
MIRT768513	hsa-miR-4731-3p	CLIP-seq
MIRT2470210	hsa-miR-4738-3p	CLIP-seq
MIRT2470211	hsa-miR-4768-3p	CLIP-seq
MIRT2470212	hsa-miR-4779	CLIP-seq
MIRT768517	hsa-miR-4786-3p	CLIP-seq
MIRT768519	hsa-miR-4801	CLIP-seq
MIRT2470213	hsa-miR-484	CLIP-seq
MIRT2167635	hsa-miR-485-5p	CLIP-seq
MIRT2470214	hsa-miR-486-5p	CLIP-seq
MIRT768521	hsa-miR-513b	CLIP-seq
MIRT2470215	hsa-miR-520a-5p	CLIP-seq
MIRT2470216	hsa-miR-525-5p	CLIP-seq
MIRT2470217	hsa-miR-646	CLIP-seq
MIRT768525	hsa-miR-665	CLIP-seq
MIRT2470218	hsa-miR-671-3p	CLIP-seq
MIRT768526	hsa-miR-671-5p	CLIP-seq
MIRT2470219	hsa-miR-761	CLIP-seq
MIRT2470220	hsa-miR-767-3p	CLIP-seq
MIRT2470221	hsa-miR-922	CLIP-seq
MIRT2470181	hsa-miR-1225-3p	CLIP-seq
MIRT2470182	hsa-miR-1226	CLIP-seq
MIRT2470183	hsa-miR-1233	CLIP-seq
MIRT2470184	hsa-miR-1263	CLIP-seq
MIRT2470185	hsa-miR-129-3p	CLIP-seq
MIRT2674551	hsa-miR-1324	CLIP-seq
MIRT2470186	hsa-miR-1470	CLIP-seq
MIRT2167614	hsa-miR-153	CLIP-seq
MIRT2470187	hsa-miR-203	CLIP-seq
MIRT2470188	hsa-miR-214	CLIP-seq
MIRT2470189	hsa-miR-2861	CLIP-seq
MIRT768530	hsa-miR-2909	CLIP-seq
MIRT768532	hsa-miR-296-5p	CLIP-seq
MIRT768467	hsa-miR-3064-3p	CLIP-seq
MIRT1545143	hsa-miR-3140-5p	CLIP-seq
MIRT2470191	hsa-miR-3147	CLIP-seq
MIRT2470192	hsa-miR-3155	CLIP-seq
MIRT2470193	hsa-miR-3155b	CLIP-seq
MIRT2674552	hsa-miR-3180-5p	CLIP-seq
MIRT2470194	hsa-miR-3619-5p	CLIP-seq
MIRT2470195	hsa-miR-3620	CLIP-seq
MIRT768533	hsa-miR-3622a-3p	CLIP-seq
MIRT768534	hsa-miR-3622b-3p	CLIP-seq
MIRT2470196	hsa-miR-3663-5p	CLIP-seq
MIRT2470198	hsa-miR-3670	CLIP-seq
MIRT768535	hsa-miR-3672	CLIP-seq
MIRT2470199	hsa-miR-370	CLIP-seq
MIRT2470200	hsa-miR-3920	CLIP-seq
MIRT2167623	hsa-miR-3921	CLIP-seq
MIRT2470201	hsa-miR-4267	CLIP-seq
MIRT768488	hsa-miR-4271	CLIP-seq
MIRT2470202	hsa-miR-4291	CLIP-seq
MIRT768489	hsa-miR-4294	CLIP-seq
MIRT2470203	hsa-miR-4303	CLIP-seq
MIRT768536	hsa-miR-4324	CLIP-seq
MIRT768537	hsa-miR-4329	CLIP-seq
MIRT2470205	hsa-miR-4425	CLIP-seq
MIRT768492	hsa-miR-4433	CLIP-seq
MIRT2470206	hsa-miR-4506	CLIP-seq
MIRT2470207	hsa-miR-4512	CLIP-seq
MIRT2167631	hsa-miR-4653-5p	CLIP-seq
MIRT2470208	hsa-miR-4660	CLIP-seq
MIRT768508	hsa-miR-4682	CLIP-seq
MIRT768511	hsa-miR-4725-3p	CLIP-seq
MIRT768513	hsa-miR-4731-3p	CLIP-seq
MIRT2470210	hsa-miR-4738-3p	CLIP-seq
MIRT768517	hsa-miR-4786-3p	CLIP-seq
MIRT768519	hsa-miR-4801	CLIP-seq
MIRT2470213	hsa-miR-484	CLIP-seq
MIRT2470214	hsa-miR-486-5p	CLIP-seq
MIRT2470215	hsa-miR-520a-5p	CLIP-seq
MIRT2470216	hsa-miR-525-5p	CLIP-seq
MIRT2167637	hsa-miR-638	CLIP-seq
MIRT2470217	hsa-miR-646	CLIP-seq
MIRT768525	hsa-miR-665	CLIP-seq
MIRT2470218	hsa-miR-671-3p	CLIP-seq
MIRT2470219	hsa-miR-761	CLIP-seq
MIRT2470220	hsa-miR-767-3p	CLIP-seq
MIRT2470221	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	TAS	1840603
GO:0005515	Function	Protein binding	IPI	25416956, 32814053, 33961781
GO:0005516	Function	Calmodulin binding	IEA
GO:0005634	Component	Nucleus	IDA	16289097
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	25978380
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25978380
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005912	Component	Adherens junction	IBA
GO:0005912	Component	Adherens junction	IDA	25978380
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0008093	Function	Cytoskeletal anchor activity	IDA	7642559
GO:0008290	Component	F-actin capping protein complex	IDA	8626479
GO:0014069	Component	Postsynaptic density	IBA
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030036	Process	Actin cytoskeleton organization	IC	3693401
GO:0030036	Process	Actin cytoskeleton organization	IDA	7642559
GO:0030054	Component	Cell junction	IEA
GO:0030507	Function	Spectrin binding	IDA	7642559
GO:0032535	Process	Regulation of cellular component size	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	7642559
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046982	Function	Protein heterodimerization activity	IPI	7642559
GO:0046983	Function	Protein dimerization activity	IPI	7642559
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IDA	7642559
GO:0051016	Process	Barbed-end actin filament capping	IBA
GO:0051016	Process	Barbed-end actin filament capping	IDA	8626479
GO:0051017	Process	Actin filament bundle assembly	IDA	3693401
GO:0051094	Process	Positive regulation of developmental process	IEA
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	16289097
GO:0071277	Process	Cellular response to calcium ion	IDA	25978380
GO:1903142	Process	Positive regulation of establishment of endothelial barrier	IBA
GO:1903142	Process	Positive regulation of establishment of endothelial barrier	IDA	25978380
GO:1903393	Process	Positive regulation of adherens junction organization	IBA
GO:1903393	Process	Positive regulation of adherens junction organization	IDA	25978380
GO:2000026	Process	Regulation of multicellular organismal development	IEA

Other IDs

• MIM: 102680
• HGNC: 243
• e!Ensembl: ENSG00000087274

Protein

• UniProt ID: P35611
• Protein name: Alpha-adducin (Erythrocyte adducin subunit alpha)
• Protein function: Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to calmodulin.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00596	Aldolase_II	147 → 329	Class II Aldolase and Adducin N-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in all tissues. Found in much higher levels in reticulocytes than the beta subunit.
• Sequence:

  MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMMEQKKRVSM
  ILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPNVYPAAPQGGMAALNMS
  LGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHF
  LIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFTLHSAIYAARPDVKCVVHI
  HTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEEEKVLIQKNLGPKSKVLILR
  NHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYKAKSRSPGSPV
  GEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPALREKSKKYSDVEVPASVTGYS
  FASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASEEGQNGSSPKSKTKWTKEDGHRT
  STSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQGELVT
  ASKAIIEKEYQPHVIVSTTGPNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKS
  PPDQPAVPHPPPSTPIKLEEDLVPEPTTGDDSDAATFKPTLPDLSPDEPSEALGFPMLEK
  EEEAHRPPSPTEAPTEASPEPAPDPAPVAEEAAPSAVEEGAAADPGSDGSPGKSPSKKKK
  KFRTPSFLKKSKKKSDS

• Sequence length: 737

Pathways

Reactome:

Caspase-mediated cleavage of cytoskeletal proteins
XBP1(S) activates chaperone genes
Miscellaneous transport and binding events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Esophageal atresia/tracheoesophageal fistula	Likely pathogenic	rs1731205978	RCV001172284	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ADD1-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROSCHISIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
hydrochlorothiazide response - Efficacy	drug response	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA, FAMILIAL COMBINED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension, salt-sensitive essential, susceptibility to	drug response	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	11283377, 12052841, 23540412		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11283377, 12052841, 23540412		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of lung	Lung carcinoma	BEFREE	31399647		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12052841, 16702981, 17082469		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	12052841		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31760884	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	21339657	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11283377, 11926892, 14684671, 15301563, 15699449, 17189961, 18458162, 21194526		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	11926892		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	11918733, 12697976, 13679477		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19274077		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	19274077	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25816007		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25816007	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17452507		★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	12107246		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15699449, 16043664, 17984662		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	15699449, 16043664, 17984662		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	17984662, 18657677		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	18657677, 35866398	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12052841, 15699449, 16043664, 16702981, 17984662, 18458162		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15187197, 28872890		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15187197, 28872890		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30062972	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15187197		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17003363		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	17003363		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15187197		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	10024330, 10371374, 10373211, 10673730, 10912757, 11116113, 11710759, 12195119, 12571619, 14508192, 15326084, 15467511, 15474463, 15554870, 15608390, 15716695, 16497648, 21228790, 22272309, 23509723, 23691048, 24718403, 25567773, 26042478, 26335431, 28686109, 28872890, 29049185, 7875756, 9004089, 9149697, 9377722, 9495254, 9582105, 9607391, 9886871		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	Pubtator	10720960, 11710759, 12427140, 15608390, 23509723, 23691048, 24718403, 28686109, 29049185, 30062972, 32555714, 39352780, 9582105, 9607177	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastroschisis	Gastroschisis	BEFREE	17051589, 29550988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastroschisis	Gastroschisis	Pubtator	27616475	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	17452507		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	18279468	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	7541641		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	1284592, 1345173, 7959767		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	GWASDB_DG	22387017		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperaldosteronism	Hyperaldosteronism	LHGDN	12107246		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	11775124		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemias	Hyperlipidemia	Pubtator	35866398	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	11728946, 12427140, 15055253, 15097233, 15608390, 18398333, 18657677, 19148102, 23509723, 30062972, 38573093, 39352780, 9582105, 9607177	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	10024330, 10371374, 10523341, 10723114, 10856280, 10912755, 10912756, 10912758, 10912759, 11116113, 11528213, 11775124, 11847182, 11926892, 12052841, 12195118, 12195119, 12427140, 12924618, 14643575, 14965315, 15055253, 15097233, 15201536, 15326084, 15528469, 15608390, 16207143, 16392768, 16612256, 16702981, 17003363, 17082469, 17301826, 17472579, 17984662, 18458162, 18657677, 18667944, 19145769, 19443911, 19960031, 20145305, 20927398, 21228790, 21364877, 22810272, 23509723, 23540412, 24271554, 25035152, 26042478, 27480094, 28040068, 30552709, 31805646, 7875756, 9004089, 9377722, 9488207, 9495254, 9582105, 9607177, 9607391, 9678591		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	12195119, 14508192, 15055253, 15097233, 16612256, 17003363, 17984662, 18393230, 18524856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	15773232, 19199261		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypotension	Hypotension	Pubtator	27940662	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	12885793, 24271554		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ischemic stroke	Ischemic Stroke	BEFREE	21194526, 23540412		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	11143997, 11918733, 15187197		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11918733, 39352780	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	16612256		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	11918733	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	11918733, 12697976, 13679477		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	12195118		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15041225		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15041225		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	19363144		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26279304	Associate	★☆☆☆☆ Found in Text Mining only
Malignant hyperthermia susceptibility type 1	Malignant hyperthermia	Pubtator	9607177	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31399647		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25816007		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	18667944		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	LHGDN	18667944		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10723114, 11926892, 14684671, 15039125, 15301563, 16420563, 17189961, 18458162, 19145769		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	11926892, 19145769		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	28032742		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30290240		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	12052841		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	12697976, 13679477		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	15041225		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	38573093	Associate	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	12885793		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25816007		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25816007	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	18657677	Associate	★☆☆☆☆ Found in Text Mining only
Xerocytosis	Xerocytosis	BEFREE	9883810		★☆☆☆☆ Found in Text Mining only