Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	1178
Gene name	Charcot-Leyden crystal galectin
Gene symbol	CLC
Synonyms (NCBI Gene)	GAL10Gal-10LGALS10LGALS10ALPPL_HUMAN
Chromosome	19
Chromosome location	19q13.2
Summary	Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to gly

Show/Hide all (3)

miRTarBase ID	miRNA	Experiments
MIRT1965249	hsa-miR-182	CLIP-seq
MIRT1965250	hsa-miR-3189-3p	CLIP-seq
MIRT1965251	hsa-miR-502-5p	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002667	Process	Regulation of T cell anergy	IMP	17502455
GO:0002724	Process	Regulation of T cell cytokine production	IMP	17502455
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IDA	11834744
GO:0005515	Function	Protein binding	IPI	11834744
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	17502455
GO:0005829	Component	Cytosol	IEA
GO:0030246	Function	Carbohydrate binding	IBA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0031012	Component	Extracellular matrix	HDA	28344315
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0046006	Process	Regulation of activated T cell proliferation	IMP	17502455
GO:0070231	Process	T cell apoptotic process	IDA	17502455

MIM	HGNC	e!Ensembl
153310	2014	ENSG00000105205

Q05315

Protein name

Galectin-10 (Gal-10) (Charcot-Leyden crystal protein) (CLC) (Eosinophil lysophospholipase) (Lysolecithin acylhydrolase)

Protein function

Regulates immune responses through the recognition of cell-surface glycans. Essential for the anergy and suppressive function of CD25-positive regulatory T-cells (Treg).

PDB

1G86 , 1HDK , 1LCL , 1QKQ , 5XRG , 5XRH , 5XRI , 5XRJ , 5XRK , 5XRL , 5XRM , 5XRN , 5XRO , 5XRP , 5YT4 , 6A1S , 6A1T , 6A1U , 6A1V , 6A1X , 6A1Y , 6GKQ , 6GKS , 6GKT , 6GKU , 6GLW , 6GLX , 6L64 , 6L67 , 6L68 , 6L6A , 6L6B , 6L6C , 6L6D , 6QRN , 8JAE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00337	Gal-bind_lectin	5 → 137	Galactoside-binding lectin	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed abundantly in the bone marrow. Expressed exclusively by eosinophils and basophils. Not detected in monocytes and neutrophils. Expressed in CD25-positive regulatory T-cells (Treg) (at protein level). Found in intestinal tissue

Sequence

MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGR
RVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEA
VKMVQVWRDISLTKFNVSYLKR

Sequence length

142

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Abnormality of neuronal migration	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Galactosemias	Galactosemia	Pubtator	22613355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CLC (Charcot-Leyden crystal galectin)