TAGAP (T cell activation RhoGTPase activating protein)

Gene

• Entrez ID: 117289
• Gene name: T cell activation RhoGTPase activating protein
• Gene symbol: TAGAP
• Synonyms (NCBI Gene): ARHGAP47, FKSG15, IDDM21, TAGAP1
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: This gene encodes a member of the Rho GTPase-activator protein superfamily. The encoded protein may function as a Rho GTPase-activating protein. Alterations in this gene may be associated with several diseases, including rheumatoid arthritis, celiac disea

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT439486	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT439486	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT1410049	hsa-miR-106a	CLIP-seq
MIRT1410050	hsa-miR-106b	CLIP-seq
MIRT1410051	hsa-miR-139-5p	CLIP-seq
MIRT1410052	hsa-miR-17	CLIP-seq
MIRT1410053	hsa-miR-20a	CLIP-seq
MIRT1410054	hsa-miR-20b	CLIP-seq
MIRT1410055	hsa-miR-2682	CLIP-seq
MIRT1410056	hsa-miR-3189-5p	CLIP-seq
MIRT1410057	hsa-miR-371b-3p	CLIP-seq
MIRT1410058	hsa-miR-4438	CLIP-seq
MIRT1410059	hsa-miR-449c	CLIP-seq
MIRT1410060	hsa-miR-4514	CLIP-seq
MIRT1410061	hsa-miR-4692	CLIP-seq
MIRT1410062	hsa-miR-4758-3p	CLIP-seq
MIRT1410063	hsa-miR-5095	CLIP-seq
MIRT1410064	hsa-miR-519d	CLIP-seq
MIRT1410065	hsa-miR-548ac	CLIP-seq
MIRT1410066	hsa-miR-548ae	CLIP-seq
MIRT1410067	hsa-miR-548aj	CLIP-seq
MIRT1410068	hsa-miR-548am	CLIP-seq
MIRT1410069	hsa-miR-548d-3p	CLIP-seq
MIRT1410070	hsa-miR-548t	CLIP-seq
MIRT1410071	hsa-miR-548x	CLIP-seq
MIRT1410072	hsa-miR-548z	CLIP-seq
MIRT1410073	hsa-miR-93	CLIP-seq
MIRT1410051	hsa-miR-139-5p	CLIP-seq
MIRT1410055	hsa-miR-2682	CLIP-seq
MIRT1410074	hsa-miR-374c	CLIP-seq
MIRT1410075	hsa-miR-4277	CLIP-seq
MIRT1410058	hsa-miR-4438	CLIP-seq
MIRT1410059	hsa-miR-449c	CLIP-seq
MIRT1410060	hsa-miR-4514	CLIP-seq
MIRT1410061	hsa-miR-4692	CLIP-seq
MIRT1410063	hsa-miR-5095	CLIP-seq
MIRT1410076	hsa-miR-655	CLIP-seq
MIRT2122887	hsa-miR-21	CLIP-seq
MIRT2122888	hsa-miR-28-5p	CLIP-seq
MIRT2122889	hsa-miR-3139	CLIP-seq
MIRT2122890	hsa-miR-4272	CLIP-seq
MIRT2122891	hsa-miR-513c	CLIP-seq
MIRT2122892	hsa-miR-514b-5p	CLIP-seq
MIRT2122893	hsa-miR-590-5p	CLIP-seq
MIRT2122894	hsa-miR-708	CLIP-seq
MIRT2461117	hsa-miR-1323	CLIP-seq
MIRT2461118	hsa-miR-2276	CLIP-seq
MIRT2461119	hsa-miR-4420	CLIP-seq
MIRT2461120	hsa-miR-548o	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0035023	Process	Regulation of Rho protein signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

Other IDs

• MIM: 609667
• HGNC: 15669
• e!Ensembl: ENSG00000164691

Protein

• UniProt ID: Q8N103
• Protein name: T-cell activation Rho GTPase-activating protein (T-cell activation GTPase-activating protein)
• Protein function: May function as a GTPase-activating protein and may play important roles during T-cell activation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00620	RhoGAP	101 → 250	RhoGAP domain	Domain

• Sequence:

  MKLRSSHNASKTLNANNMETLIECQSEGDIKEHPLLASCESEDSICQLIEVKKRKKVLSW
  PFLMRRLSPASDFSGALETDLKASLFDQPLSIICGDSDTLPRPIQDILTILCLKGPSTEG
  IFRRAANEKARKELKEELNSGDAVDLERLPVHLLAVVFKDFLRSIPRKLLSSDLFEEWMG
  ALEMQDEEDRIEALKQVADKLPRPNLLLLKHLVYVLHLISKNSEVNRMDSSNLAICIGPN
  MLTLENDQSLSFEAQKDLNNKVKTLVEFLIDNCFEIFGENIPVHSSITSDDSLEHTDSSD
  VSTLQNDSAYDSNDPDVESNSSSGISSPSRQPQVPMATAAGLDSAGPQDAREVSPEPIVS
  TVARLKSSLAQPDRRYSEPSMPSSQECLESRVTNQTLTKSEGDFPVPRVGSRLESEEAED
  PFPEEVFPAVQGKTKRPVDLKIKNLAPGSVLPRALVLKAFSSSSLDASSDSSPVASPSSP
  KRNFFSRHQSFTTKTEKGKPSREIKKHSMSFTFAPHKKVLTKNLSAGSGKSQDFTRDHVP
  RGVRKESQLAGRIVQENGCETHNQTARGFCLRPHALSVDDVFQGADWERPGSPPSYEEAM
  QGPAARLVASESQTVGSMTVGSMRARMLEAHCLLPPLPPAHHVEDSRHRGSKEPLPGHGL
  SPLPERWKQSRTVHASGDSLGHVSGPGRPELLPLRTVSESVQRNKRDCLVRRCSQPVFEA
  DQFQYAKESYI

• Sequence length: 731

Pathways

Reactome:

Rho GTPase cycle

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis	Arthritis	BEFREE	29017772		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19898481, 20854658, 21390051, 22127930, 23242182, 29329296, 32398702	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASDB_DG	21150878		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20854658, 23143594, 28462950, 29329296		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	20854658, 29329296	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASDB_DG	21383967		★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	38615592	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35739510	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASCAT_DG	18311140, 20190752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASDB_DG	18311140, 20190752, 24999842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	BEFREE	19073967, 21298027, 27015091, 28208589, 28462950, 30402962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	19073967, 21390051, 22087237, 26859134, 27015091	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	21102463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	23044675, 24582067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	21102463		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	21102463		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19073967, 20854658, 21390051	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19073967		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	24582067		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	38615592	Inhibit	★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	21102463		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	19898481	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	GWASDB_DG	21383967		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35030632	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	21833088, 22190364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	21833088, 22190364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26765264, 28356229, 28462950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	26765264, 29329296	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	23143594		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	28462950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	23143594		★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	21102463		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	20453842, 23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20854658, 21390051, 22127930, 23242182, 28462950, 29017772, 29329296		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	23044675, 24582067		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37963845	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22592522, 30402962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations