Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	117283
Gene name	Inositol hexakisphosphate kinase 3
Gene symbol	IP6K3
Synonyms (NCBI Gene)	IHPK3INSP6K3
Chromosome	6
Chromosome location	6p21.31
Summary	This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,

Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038242	hsa-miR-330-5p	CLASH	23622248
MIRT727440	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727439	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727438	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727436	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727437	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT1068443	hsa-miR-2276	CLIP-seq
MIRT1068444	hsa-miR-4286	CLIP-seq
MIRT2016661	hsa-miR-2053	CLIP-seq
MIRT2016662	hsa-miR-214	CLIP-seq
MIRT2016663	hsa-miR-30a	CLIP-seq
MIRT2016664	hsa-miR-30b	CLIP-seq
MIRT2016665	hsa-miR-30c	CLIP-seq
MIRT2016666	hsa-miR-30d	CLIP-seq
MIRT2016667	hsa-miR-30e	CLIP-seq
MIRT2016668	hsa-miR-3619-5p	CLIP-seq
MIRT2016669	hsa-miR-3680	CLIP-seq
MIRT2016670	hsa-miR-375	CLIP-seq
MIRT2016671	hsa-miR-3922-5p	CLIP-seq
MIRT2016672	hsa-miR-4291	CLIP-seq
MIRT2016673	hsa-miR-4639-3p	CLIP-seq
MIRT2016674	hsa-miR-4680-5p	CLIP-seq
MIRT2016675	hsa-miR-569	CLIP-seq
MIRT2016676	hsa-miR-643	CLIP-seq
MIRT2016677	hsa-miR-646	CLIP-seq
MIRT2016678	hsa-miR-761	CLIP-seq
MIRT2016679	hsa-miR-889	CLIP-seq
MIRT2016680	hsa-miR-922	CLIP-seq
MIRT1068443	hsa-miR-2276	CLIP-seq
MIRT1068444	hsa-miR-4286	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000827	Function	Inositol-1,3,4,5,6-pentakisphosphate kinase activity	IEA
GO:0000827	Function	Inositol-1,3,4,5,6-pentakisphosphate kinase activity	TAS
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IBA
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IDA	11502751
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IEA
GO:0000828	Function	Inositol hexakisphosphate kinase activity	TAS
GO:0000829	Function	Diphosphoinositol pentakisphosphate kinase activity	IEA
GO:0000829	Function	Diphosphoinositol pentakisphosphate kinase activity	TAS
GO:0000831	Function	Inositol hexakisphosphate 6-kinase activity	IDA	11502751
GO:0000832	Function	Inositol hexakisphosphate 5-kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11502751
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	11502751
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032958	Process	Inositol phosphate biosynthetic process	IBA
GO:0032958	Process	Inositol phosphate biosynthetic process	IDA	11502751
GO:0032958	Process	Inositol phosphate biosynthetic process	IEA
GO:0040011	Process	Locomotion	IEA
GO:0043647	Process	Inositol phosphate metabolic process	IEA
GO:0043647	Process	Inositol phosphate metabolic process	TAS
GO:0046488	Process	Phosphatidylinositol metabolic process	IDA	11502751
GO:0046488	Process	Phosphatidylinositol metabolic process	IEA
GO:0046854	Process	Phosphatidylinositol phosphate biosynthetic process	IBA
GO:0052836	Function	Inositol 5-diphosphate pentakisphosphate 5-kinase activity	IEA
GO:0052836	Function	Inositol 5-diphosphate pentakisphosphate 5-kinase activity	TAS
GO:0052839	Function	Diphosphoinositol tetrakisphosphate kinase activity	IEA
GO:0052839	Function	Diphosphoinositol tetrakisphosphate kinase activity	TAS
GO:0090407	Process	Organophosphate biosynthetic process	IEA

MIM	HGNC	e!Ensembl
606993	17269	ENSG00000161896

Q96PC2

Protein name

Inositol hexakisphosphate kinase 3 (InsP6 kinase 3) (EC 2.7.4.21) (Inositol hexaphosphate kinase 3)

Protein function

Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03770	IPK	198 → 404	Inositol polyphosphate kinase	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in brain.

Sequence

MVVQNSADAGDMRAGVQLEPFLHQVGGHMSVMKYDEHTVCKPLVSREQRFYESLPLAMKR
FTPQYKGTVTVHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSD
CTLAQWPHAQLARSPKESPAKALLRSEPHLNTPAFSLVEDTNGNQVERKSFNPWGLQCHQ
AHLTRLCSEYPENKRHRFLLLENVVSQYTHPCVLDLKMGTRQHGDDASEEKKARHMRKCA
QSTSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGFRQALYQFLHNGSHLRRELLE
PILHQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGL
TKVDIRMIDFAHTTYKGYWNEHTTYDGPDPGYIFGLENLIRILQDIQEGE

Sequence length

410

Interactions

View interactions

	KEGG		Reactome
	Phosphatidylinositol signaling system		Synthesis of pyrophosphates in the cytosol

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	27345265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	27345265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	30718399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	30284222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31185018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27345265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 19503088, 21156761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

IP6K3 (inositol hexakisphosphate kinase 3)