Gene Gene information from NCBI Gene database.
Entrez ID 117143
Gene name Transcriptional adaptor 1
Gene symbol TADA1
Synonyms (NCBI Gene)
ADA1HFI1STAF42TADA1LhADA1
Chromosome 1
Chromosome location 1q24.1
Summary TADA1L is a protein subunit of the human STAGA complex (SPT3; (MIM 602947)/TAF9 (MIM 600822)/GCN5 (MIM 602301) acetyltransferase complex), which is a chromatin-modifying multiprotein complex (Martinez et al., 2001 [PubMed 11564863]).[supplied by OMIM, Apr
miRNA miRNA information provided by mirtarbase database.
227
miRTarBase ID miRNA Experiments Reference
MIRT1408627 hsa-miR-1245 CLIP-seq
MIRT1408628 hsa-miR-1279 CLIP-seq
MIRT1408629 hsa-miR-1284 CLIP-seq
MIRT1408630 hsa-miR-1323 CLIP-seq
MIRT1408631 hsa-miR-135a CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0000124 Component SAGA complex IBA
GO:0000124 Component SAGA complex IDA 11564863
GO:0000124 Component SAGA complex NAS 19114550
GO:0003713 Function Transcription coactivator activity IBA
GO:0003713 Function Transcription coactivator activity IDA 11564863
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612763 30631 ENSG00000152382
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96BN2
Protein name Transcriptional adapter 1 (SPT3-associated factor 42) (STAF42) (Transcriptional adapter 1-like protein)
Protein function Probably involved in transcriptional regulation.
PDB 7KTR , 7KTS , 8H7G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12767 SAGA-Tad1 6 129 Transcriptional regulator of RNA polII, SAGA, subunit Family
PF12767 SAGA-Tad1 114 194 Transcriptional regulator of RNA polII, SAGA, subunit Family
Sequence
MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHN
DFLLAILTRCQILVSTPDGAGSLPWPGGSAAKPGKPKGKKKLSSVRQKFDHRF
QPQNPLS
GAQQFVAKD
PQDDDDLKLCSHTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVE
NHLKDILTSVVSRR
KAYRLRDGHFKYAFGSNVTPQPYLKNSVVAYNNLIESPPAFTAPCA
GQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALN
IERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
Sequence length 335
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Nonpapillary renal cell carcinoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 30581348
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 30581348
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 30641086
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 12632419, 20943049 Associate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 16754522
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 30641086
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism BEFREE 11121182
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 35663977 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 35663977 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 35663977 Associate
★☆☆☆☆
Found in Text Mining only