Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	116986
Gene name	ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
Gene symbol	AGAP2
Synonyms (NCBI Gene)	CENTG1GGAP2PIKE
Chromosome	12
Chromosome location	12q14.1
Summary	The protein encoded by this gene belongs to the centaurin gamma-like family. It mediates anti-apoptotic effects of nerve growth factor by activating nuclear phosphoinositide 3-kinase. It is overexpressed in cancer cells, and promotes cancer cell invasion.

Show/Hide all (96)

miRTarBase ID	miRNA	Experiments
MIRT771611	hsa-miR-1183	CLIP-seq
MIRT771612	hsa-miR-1324	CLIP-seq
MIRT771613	hsa-miR-1471	CLIP-seq
MIRT771614	hsa-miR-3156-3p	CLIP-seq
MIRT771615	hsa-miR-3162-3p	CLIP-seq
MIRT771616	hsa-miR-342-5p	CLIP-seq
MIRT771617	hsa-miR-4301	CLIP-seq
MIRT771618	hsa-miR-4313	CLIP-seq
MIRT771619	hsa-miR-4664-5p	CLIP-seq
MIRT771620	hsa-miR-615-5p	CLIP-seq
MIRT771621	hsa-miR-642b	CLIP-seq
MIRT1927709	hsa-miR-4447	CLIP-seq
MIRT1927710	hsa-miR-4472	CLIP-seq
MIRT1927711	hsa-miR-4492	CLIP-seq
MIRT1927712	hsa-miR-4498	CLIP-seq
MIRT1927713	hsa-miR-4505	CLIP-seq
MIRT1927714	hsa-miR-762	CLIP-seq
MIRT1927715	hsa-miR-1207-5p	CLIP-seq
MIRT1927716	hsa-miR-1321	CLIP-seq
MIRT771612	hsa-miR-1324	CLIP-seq
MIRT1927717	hsa-miR-1827	CLIP-seq
MIRT1927718	hsa-miR-3126-5p	CLIP-seq
MIRT1927719	hsa-miR-3612	CLIP-seq
MIRT1927720	hsa-miR-3940-5p	CLIP-seq
MIRT1927721	hsa-miR-4419a	CLIP-seq
MIRT1927722	hsa-miR-4446-3p	CLIP-seq
MIRT1927711	hsa-miR-4492	CLIP-seq
MIRT1927712	hsa-miR-4498	CLIP-seq
MIRT1927713	hsa-miR-4505	CLIP-seq
MIRT1927723	hsa-miR-4507	CLIP-seq
MIRT1927724	hsa-miR-4510	CLIP-seq
MIRT1927725	hsa-miR-4640-5p	CLIP-seq
MIRT1927726	hsa-miR-4690-3p	CLIP-seq
MIRT1927727	hsa-miR-4726-5p	CLIP-seq
MIRT1927728	hsa-miR-4739	CLIP-seq
MIRT1927729	hsa-miR-4756-5p	CLIP-seq
MIRT1927730	hsa-miR-4763-3p	CLIP-seq
MIRT1927731	hsa-miR-647	CLIP-seq
MIRT1927732	hsa-miR-650	CLIP-seq
MIRT1927714	hsa-miR-762	CLIP-seq
MIRT1927733	hsa-miR-940	CLIP-seq
MIRT1927715	hsa-miR-1207-5p	CLIP-seq
MIRT2168487	hsa-miR-1273f	CLIP-seq
MIRT2168488	hsa-miR-1285	CLIP-seq
MIRT2168489	hsa-miR-143	CLIP-seq
MIRT2168490	hsa-miR-2110	CLIP-seq
MIRT1927718	hsa-miR-3126-5p	CLIP-seq
MIRT2168491	hsa-miR-3127-3p	CLIP-seq
MIRT2168492	hsa-miR-3155	CLIP-seq
MIRT2168493	hsa-miR-3155b	CLIP-seq
MIRT2168494	hsa-miR-3187-5p	CLIP-seq
MIRT2168495	hsa-miR-34a	CLIP-seq
MIRT2168496	hsa-miR-34c-5p	CLIP-seq
MIRT2168497	hsa-miR-3689a-3p	CLIP-seq
MIRT2168498	hsa-miR-3689c	CLIP-seq
MIRT2168499	hsa-miR-4271	CLIP-seq
MIRT2168500	hsa-miR-4420	CLIP-seq
MIRT1927711	hsa-miR-4492	CLIP-seq
MIRT1927712	hsa-miR-4498	CLIP-seq
MIRT2168501	hsa-miR-449a	CLIP-seq
MIRT2168502	hsa-miR-449b	CLIP-seq
MIRT1927713	hsa-miR-4505	CLIP-seq
MIRT2168503	hsa-miR-4708-5p	CLIP-seq
MIRT2168504	hsa-miR-4725-3p	CLIP-seq
MIRT2168505	hsa-miR-4728-5p	CLIP-seq
MIRT1927730	hsa-miR-4763-3p	CLIP-seq
MIRT2168506	hsa-miR-4770	CLIP-seq
MIRT2168507	hsa-miR-484	CLIP-seq
MIRT2168508	hsa-miR-612	CLIP-seq
MIRT2168509	hsa-miR-711	CLIP-seq
MIRT1927714	hsa-miR-762	CLIP-seq
MIRT2443300	hsa-miR-3922-5p	CLIP-seq
MIRT2443301	hsa-miR-4687-5p	CLIP-seq
MIRT2443302	hsa-miR-624	CLIP-seq
MIRT2471072	hsa-miR-1275	CLIP-seq
MIRT2471073	hsa-miR-186	CLIP-seq
MIRT2471074	hsa-miR-1913	CLIP-seq
MIRT2471075	hsa-miR-324-3p	CLIP-seq
MIRT2443300	hsa-miR-3922-5p	CLIP-seq
MIRT2471076	hsa-miR-4506	CLIP-seq
MIRT2471077	hsa-miR-4525	CLIP-seq
MIRT2471078	hsa-miR-4665-5p	CLIP-seq
MIRT2443301	hsa-miR-4687-5p	CLIP-seq
MIRT2471079	hsa-miR-4722-3p	CLIP-seq
MIRT2471080	hsa-miR-4723-5p	CLIP-seq
MIRT2168505	hsa-miR-4728-5p	CLIP-seq
MIRT2471081	hsa-miR-4749-3p	CLIP-seq
MIRT771620	hsa-miR-615-5p	CLIP-seq
MIRT2443302	hsa-miR-624	CLIP-seq
MIRT2471082	hsa-miR-625	CLIP-seq
MIRT2471083	hsa-miR-639	CLIP-seq
MIRT2471084	hsa-miR-720	CLIP-seq
MIRT2471085	hsa-miR-938	CLIP-seq
MIRT2443300	hsa-miR-3922-5p	CLIP-seq
MIRT2443301	hsa-miR-4687-5p	CLIP-seq
MIRT2443302	hsa-miR-624	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	11136977, 12640130
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	18374643
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	1238857
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	20075866, 21720388
GO:0005524	Function	ATP binding	IDA	11136977
GO:0005525	Function	GTP binding	IDA	11136977, 12640130
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	14761976
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	18374643
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	14761976
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	18374643
GO:0005768	Component	Endosome	IDA	12388557
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016197	Process	Endosomal transport	IDA	12388557
GO:0019901	Function	Protein kinase binding	IDA	14761976
GO:0030036	Process	Actin cytoskeleton organization	IDA	12388557
GO:0030295	Function	Protein kinase activator activity	IDA	14761976
GO:0035014	Function	Phosphatidylinositol 3-kinase regulator activity	IDA	11136977
GO:0042177	Process	Negative regulation of protein catabolic process	IDA	18374643
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IBA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IGI	18374643
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	14761976
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	18570454
GO:0090543	Component	Flemming body	IDA
GO:0141038	Function	Phosphatidylinositol 3-kinase activator activity	TAS	18374643

MIM	HGNC	e!Ensembl
605476	16921	ENSG00000135439

Q99490

Protein name

Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 (AGAP-2) (Centaurin-gamma-1) (Cnt-g1) (GTP-binding and GTPase-activating protein 2) (GGAP2) (Phosphatidylinositol 3-kinase enhancer) (PIKE)

Protein function

GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor

PDB

2BMJ , 2IWR , 2RLO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	408 → 568	Ras family	Domain
PF01412	ArfGap	931 → 1046	Putative GTPase activating protein for Arf	Domain
PF00023	Ank	1091 → 1122	Ankyrin repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is brain-specific. Isoform 2 is ubiquitously expressed, with highest levels in brain and heart. {ECO:0000269|PubMed:12640130, ECO:0000269|PubMed:14761976, ECO:0000269|PubMed:15118108, ECO:0000269|PubMed:16079295, ECO:0000269|

Sequence

MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAVGAPGARGSEPRDPGSPRGAEE
PGKKRHERLFHRQDALWISTSSAGAGGAEPPALSPAPASPARPVSPAPGRRLSLWAAPPG
PPLSGGLSPDSKPGGAPSSSRRPLLSSPSWGGPEPEGRTGGGVPGSSSPHPGTGSRRLKV
APPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASVSAAATA
AAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPPTPS
PATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPP
GSGPLPGPPSLSSGSGSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKS
SLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFS
LEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMK
RCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQAS
NGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEK
RSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHS
THGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLEATTPMPSPSP
SPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTT
PSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDA
WVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLN
LGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAK
PSRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGRQLWAAVQAQDVATVLLLLAHARHG
PLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCA
DILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVALV

Sequence length

1192

Interactions

View interactions

	KEGG
	FoxO signaling pathway Endocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AGAP2-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (36)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	31989994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22302350, 30157918, 30910994, 35369814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35707044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38036719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26464646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34034689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32202509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30660615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16150119, 22450747, 28368413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	16150119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20169195, 26863628, 31186379, 34899682, 37432454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22450747, 28368413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27764782, 31386624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31386624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36541122	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26464646	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28617550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19176382, 22389719, 30674964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14761976, 17297440, 22389719, 26977005, 30674964, 30833542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32462000, 35707044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	19525955, 21833088		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	21833088		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	33484325, 34855907	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myxoma	Myxoma	LHGDN	17151107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22389719, 26001218, 9192850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	15598747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28617550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28170448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31233485	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19176382, 22389719, 30674964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	19176382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22389719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	29179949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26464646, 35113007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28209205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

AGAP2 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 2)