LRG1 (leucine rich alpha-2-glycoprotein 1)

Gene

• Entrez ID: 116844
• Gene name: Leucine rich alpha-2-glycoprotein 1
• Gene symbol: LRG1
• Synonyms (NCBI Gene): HMFT1766, LRG
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O`Donnell et al.

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006448	hsa-miR-335-5p	Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22382496
MIRT006448	hsa-miR-335-5p	Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22382496
MIRT006448	hsa-miR-335-5p	Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22382496
MIRT679358	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT679357	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT679356	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT679355	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT679354	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT679352	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT679353	hsa-miR-1976	HITS-CLIP	23824327
MIRT679351	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT679350	hsa-miR-4731-5p	HITS-CLIP	23824327
MIRT679349	hsa-miR-5589-5p	HITS-CLIP	23824327
MIRT679348	hsa-miR-4279	HITS-CLIP	23824327
MIRT489906	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT489905	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT489904	hsa-miR-5011-3p	PAR-CLIP	23592263
MIRT679358	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT679357	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT679356	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT679355	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT679354	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT679352	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT679353	hsa-miR-1976	HITS-CLIP	23824327
MIRT679351	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT679350	hsa-miR-4731-5p	HITS-CLIP	23824327
MIRT679349	hsa-miR-5589-5p	HITS-CLIP	23824327
MIRT679348	hsa-miR-4279	HITS-CLIP	23824327
MIRT489906	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT489905	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT489904	hsa-miR-5011-3p	PAR-CLIP	23592263
MIRT1117558	hsa-miR-1207-3p	CLIP-seq
MIRT1117559	hsa-miR-1224-3p	CLIP-seq
MIRT1117560	hsa-miR-1252	CLIP-seq
MIRT1117561	hsa-miR-197	CLIP-seq
MIRT1117562	hsa-miR-3194-3p	CLIP-seq
MIRT1117563	hsa-miR-3199	CLIP-seq
MIRT1117564	hsa-miR-3202	CLIP-seq
MIRT1117565	hsa-miR-431	CLIP-seq
MIRT1117566	hsa-miR-4426	CLIP-seq
MIRT1117567	hsa-miR-4454	CLIP-seq
MIRT1117568	hsa-miR-4476	CLIP-seq
MIRT1117569	hsa-miR-4533	CLIP-seq
MIRT1117570	hsa-miR-4647	CLIP-seq
MIRT1117571	hsa-miR-4662a-5p	CLIP-seq
MIRT1117572	hsa-miR-4662b	CLIP-seq
MIRT1117573	hsa-miR-4716-5p	CLIP-seq
MIRT1117574	hsa-miR-5096	CLIP-seq
MIRT1117575	hsa-miR-552	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT1117577	hsa-miR-764	CLIP-seq
MIRT2033230	hsa-miR-1228	CLIP-seq
MIRT2033231	hsa-miR-1281	CLIP-seq
MIRT2033232	hsa-miR-1305	CLIP-seq
MIRT2033233	hsa-miR-145	CLIP-seq
MIRT2033234	hsa-miR-150	CLIP-seq
MIRT2033235	hsa-miR-3189-3p	CLIP-seq
MIRT1117563	hsa-miR-3199	CLIP-seq
MIRT2033236	hsa-miR-3616-3p	CLIP-seq
MIRT2033237	hsa-miR-4328	CLIP-seq
MIRT2033238	hsa-miR-4477a	CLIP-seq
MIRT2033239	hsa-miR-4735-5p	CLIP-seq
MIRT2033240	hsa-miR-4775	CLIP-seq
MIRT2033241	hsa-miR-4794	CLIP-seq
MIRT2033242	hsa-miR-498	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT2033243	hsa-miR-590-3p	CLIP-seq
MIRT2033244	hsa-miR-635	CLIP-seq
MIRT1117577	hsa-miR-764	CLIP-seq
MIRT2033234	hsa-miR-150	CLIP-seq
MIRT1117562	hsa-miR-3194-3p	CLIP-seq
MIRT2263530	hsa-miR-3672	CLIP-seq
MIRT1117565	hsa-miR-431	CLIP-seq
MIRT2033239	hsa-miR-4735-5p	CLIP-seq
MIRT2033240	hsa-miR-4775	CLIP-seq
MIRT2033241	hsa-miR-4794	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT2033243	hsa-miR-590-3p	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT1117563	hsa-miR-3199	CLIP-seq
MIRT2033241	hsa-miR-4794	CLIP-seq
MIRT1117575	hsa-miR-552	CLIP-seq
MIRT1117577	hsa-miR-764	CLIP-seq
MIRT2033231	hsa-miR-1281	CLIP-seq
MIRT2033234	hsa-miR-150	CLIP-seq
MIRT2562850	hsa-miR-24	CLIP-seq
MIRT2562851	hsa-miR-411	CLIP-seq
MIRT2562852	hsa-miR-4284	CLIP-seq
MIRT2033239	hsa-miR-4735-5p	CLIP-seq
MIRT2033240	hsa-miR-4775	CLIP-seq
MIRT2033241	hsa-miR-4794	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT2033243	hsa-miR-590-3p	CLIP-seq
MIRT2562850	hsa-miR-24	CLIP-seq
MIRT2562852	hsa-miR-4284	CLIP-seq
MIRT2033239	hsa-miR-4735-5p	CLIP-seq
MIRT2033240	hsa-miR-4775	CLIP-seq
MIRT2033241	hsa-miR-4794	CLIP-seq
MIRT1117576	hsa-miR-564	CLIP-seq
MIRT2033243	hsa-miR-590-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	23868260
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IPI	23868260
GO:0005160	Function	Transforming growth factor beta receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	23868260, 28514442, 33961781
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	12223515, 14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	20363744
GO:0005615	Component	Extracellular space	IEA
GO:0006955	Process	Immune response	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0009617	Process	Response to bacterium	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	32887674
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IEA
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IMP	32887674
GO:0016020	Component	Membrane	NAS	3856868
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IDA	23868260, 32887674
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IPI	23868260
GO:0035313	Process	Wound healing, spreading of epidermal cells	IEA
GO:0035313	Process	Wound healing, spreading of epidermal cells	IMP	32887674
GO:0035580	Component	Specific granule lumen	TAS
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IMP	32887674
GO:0045766	Process	Positive regulation of angiogenesis	IMP	23868260
GO:0050431	Function	Transforming growth factor beta binding	IBA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0051546	Process	Keratinocyte migration	IEA
GO:0051546	Process	Keratinocyte migration	IMP	32887674
GO:0060054	Process	Positive regulation of epithelial cell proliferation involved in wound healing	IEA
GO:0060054	Process	Positive regulation of epithelial cell proliferation involved in wound healing	IMP	32887674
GO:0061756	Process	Leukocyte adhesion to vascular endothelial cell	IEA
GO:0061756	Process	Leukocyte adhesion to vascular endothelial cell	IMP	32887674
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 611289
• HGNC: 29480
• e!Ensembl: ENSG00000171236

Protein

• UniProt ID: P02750
• Protein name: Leucine-rich alpha-2-glycoprotein (LRG)
• PDB: 7Q4Q, 8H24
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	71 → 128	Leucine rich repeat	Repeat
  PF13855	LRR_8	116 → 176	Leucine rich repeat	Repeat
  PF13855	LRR_8	168 → 224	Leucine rich repeat	Repeat
  PF13855	LRR_8	212 → 272	Leucine rich repeat	Repeat
  PF13855	LRR_8	236 → 285	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Plasma.
• Sequence:

  MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPA
  EIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRV
  LDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLP
  PGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRY
  LFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
  WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

• Sequence length: 347

Pathways

Reactome:

Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	28697446, 31784980		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	28697446		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	CTD_human_DG	25200834		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28376157, 30137376, 30575211, 30760292		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	27491861		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	28202345, 30391151		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28615031		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28376129		★☆☆☆☆ Found in Text Mining only
Bernard Soulier Syndrome	Bernard-soulier syndrome	Pubtator	7690959	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27491861		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27491861, 33386492	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37786278	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28697446		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26517349	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19709441	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30137376, 30575211	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31753726, 32337221, 37213667	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	31830829		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31220542		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31220542		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31186765		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31186765		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29707118		★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	34445590	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28973352		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	22374925		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33623482	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31753726		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	25200834		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26856989, 28376129, 29029535, 29642865, 29785123, 31586890, 31784980		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28376129, 31753726, 32023884, 37786278	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29707118		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	27118092, 33506919	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28434814		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22374925		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33623482, 38069288	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28358372		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30858225		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30858225		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28973352, 29883055, 30858225, 31256924		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35068329	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28973352, 29861058, 30515388, 30858225		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29168314, 31256924		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24760273		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24760273	Associate	★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	36500247	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25973038	Associate	★☆☆☆☆ Found in Text Mining only
Familial Intestinal Polyposis	Multiple polyposis syndrome	CTD_human_DG	25200834		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	19703762	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25589464, 29513714		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29513714	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25589464, 29513714		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26049667		★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	36291628	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28917663		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29550485		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33623482	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31220542		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	32252660	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31629959		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	30455412	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30455412	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30455412		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30987719		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25814288, 26517349		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23284758	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30118672		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	32252660	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	24760273		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24760273	Associate	★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	28094589		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34445590	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27491861		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	24760273		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30987719		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30575211, 30760292		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24760273, 25589464, 25826092, 26049667, 26517349, 26856989, 28098902, 28376129, 28746773, 29785123, 30760292, 31002347		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31186765		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	25200834		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31753726		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37089863	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	30987719	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28262744		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	28262744, 35699824	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35275518	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30411527, 31541797		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	33506919	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25589464, 25826092, 26517349, 28098902, 28746773, 29392314, 29785123, 30455412, 30896502, 31753726		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22382496		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22382496	Associate	★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	BEFREE	30858225		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31528707		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29883055		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36569927	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	36569927	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23579955	Stimulate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	29550485		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30575211, 30760292		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30575211, 30760292		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17303479, 30575211	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	17303479	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29883055		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	29883055		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29168314		★☆☆☆☆ Found in Text Mining only
Polyposis, Adenomatous Intestinal	Multiple polyposis syndrome	CTD_human_DG	25200834		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	30471232		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36500247	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36681849	Associate	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	29550485		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31920121, 36411774	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	36277429	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	32780727	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29392314		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22374925, 27466171, 28615031, 29550485		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	27378305	Inhibit	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	36277429	Stimulate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	31953524	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30714525		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26552850	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28098902		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28746773	Associate	★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	28094589		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31002347		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31552595		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22374925, 27466171		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34706720	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	27193112	Associate	★☆☆☆☆ Found in Text Mining only