SLC18B1 (solute carrier family 18 member B1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 116843
Gene name Solute carrier family 18 member B1
Gene symbol SLC18B1
Synonyms (NCBI Gene)
C6orf192VPATdJ55C23.6
Chromosome 6
Chromosome location 6q23.2
Summary This gene encodes a protein, which has high sequence similarity to rat, xenopus and zebrafish proteins. The protein function is unknown. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
17
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (17)
miRTarBase ID miRNA Experiments Reference
MIRT041554 hsa-miR-193b-3p CLASH 23622248
MIRT570108 hsa-miR-183-5p PAR-CLIP 20371350
MIRT570107 hsa-miR-4742-5p PAR-CLIP 20371350
MIRT570106 hsa-miR-31-5p PAR-CLIP 20371350
MIRT570105 hsa-miR-1207-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (17)
GO ID Ontology Definition Evidence Reference
GO:0000296 Process Spermine transport IDA 25355561
GO:0015311 Function Monoamine:proton antiporter activity IDA 25355561
GO:0015312 Function Polyamine:proton antiporter activity IDA 25355561
GO:0015848 Process Spermidine transport IDA 25355561
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
613361 21573 ENSG00000146409
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6NT16
Protein name MFS-type transporter SLC18B1 (Solute carrier family 18 member B1) (Vesicular polyamine transporter) (VPAT)
Protein function Proton-coupled polyamine antiporter involved in the translocation of polyamines from cytosol into secretory vesicles prior to their release via exocytosis. Uses the electrochemical proton gradient generated by a V-type proton-pumping ATPase to c
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07690 MFS_1 40 → 248 Major Facilitator Superfamily Family
PF07690 MFS_1 237 → 450 Major Facilitator Superfamily Family
Tissue specificity TISSUE SPECIFICITY: Expressed in various tissues including lung, placenta, adrenal gland, liver, testis, and brain. {ECO:0000269|PubMed:25355561}.
Sequence 
MEALGDLEGPRAPGGDDPAGSAGETPGWLSREQVFVLISAASVNLGSMMCYSILGPFFPK
EAEKKGASNTIIGMIFGCFALFELLASLVFGNYLVHIGAKFMFVAGMFVSGGVTILFGVL
DRVPDGPVFIAMCFLVRVMDAVSFAAAMTASSSILAKAFPNNVATVLGSLETFSGLGLIL
GPPVGGFLYQSFGYEVPFIVLGCVVLLMVPLNMYILPNYESDPGEHSFWKLIALPKVGLI
AFVINSLSSCFGFLDPTLSLFVLEKFNLPAGYVGLVFLGMALSYAISSPLFGLLSDKRPP
LRKWLLVFGNLITAGCYMLLGPVPILHIKSQLWLLVLILVVSGLSAGMSIIPTFPEILSC
AHENGFEEGLSTLGLVSGLFSAMWSIGAFMGPTLGGFLYEKIGFEWAAAIQGLWALISGL
AMGLFYLLEYSRRKRSKSQNILSTEEERTTLLPNET
Sequence length 456
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PARKINSON DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (2)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Sepsis Sepsis Pubtator 29885947 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Septicemia Septicemia BEFREE 29885947
★★★★★
★☆☆☆☆
Found in Text Mining only