RPL39L (ribosomal protein L39 like)

Gene

• Entrez ID: 116832
• Gene name: Ribosomal protein L39 like
• Gene symbol: RPL39L
• Synonyms (NCBI Gene): L39-2, RPL39L1
• Chromosome: 3
• Chromosome location: 3q27.3
• Summary: This gene encodes a protein sharing high sequence similarity with ribosomal protein L39. Although the name of this gene has been referred to as `ribosomal protein L39` in the public databases, its official name is `ribosomal protein L39-like`. It is not c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT048437	hsa-miR-100-5p	CLASH	23622248
MIRT1316969	hsa-miR-140-5p	CLIP-seq
MIRT1316970	hsa-miR-196a	CLIP-seq
MIRT1316971	hsa-miR-196b	CLIP-seq
MIRT1316972	hsa-miR-198	CLIP-seq
MIRT1316973	hsa-miR-3545-5p	CLIP-seq
MIRT1316974	hsa-miR-4426	CLIP-seq
MIRT1316975	hsa-miR-4460	CLIP-seq
MIRT1316976	hsa-miR-4647	CLIP-seq
MIRT1316977	hsa-miR-4662b	CLIP-seq
MIRT1316978	hsa-miR-487b	CLIP-seq
MIRT1316974	hsa-miR-4426	CLIP-seq
MIRT1316976	hsa-miR-4647	CLIP-seq
MIRT1316977	hsa-miR-4662b	CLIP-seq
MIRT1316978	hsa-miR-487b	CLIP-seq
MIRT1316972	hsa-miR-198	CLIP-seq
MIRT2094117	hsa-miR-19a	CLIP-seq
MIRT2094118	hsa-miR-19b	CLIP-seq
MIRT1316974	hsa-miR-4426	CLIP-seq
MIRT1316976	hsa-miR-4647	CLIP-seq
MIRT1316977	hsa-miR-4662b	CLIP-seq
MIRT1316978	hsa-miR-487b	CLIP-seq
MIRT1316974	hsa-miR-4426	CLIP-seq
MIRT1316976	hsa-miR-4647	CLIP-seq
MIRT1316977	hsa-miR-4662b	CLIP-seq
MIRT1316978	hsa-miR-487b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	ISS
GO:0005515	Function	Protein binding	IPI	25416956, 31515488
GO:0005737	Component	Cytoplasm	IEA
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IEA
GO:0007283	Process	Spermatogenesis	IEP	12490704
GO:0007283	Process	Spermatogenesis	ISS
GO:0022625	Component	Cytosolic large ribosomal subunit	IBA
GO:0022625	Component	Cytosolic large ribosomal subunit	ISS
GO:0022625	Component	Cytosolic large ribosomal subunit	NAS	12490704
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 607547
• HGNC: 17094
• e!Ensembl: ENSG00000163923

Protein

• UniProt ID: Q96EH5
• Protein name: Ribosomal protein eL39-like 2 (60S ribosomal protein L39-2) (60S ribosomal protein L39-like) (Large ribosomal subunit protein eL39-like)
• Protein function: Male germ cell-specific component of the ribosome, which is required for the formation of sperm and male fertility. Replaces the RPL39 paralog in the ribosome of male germ cells. The ribosome is a large ribonucleoprotein complex responsible for
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00832	Ribosomal_L39	9 → 50	Ribosomal L39 protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Testis specific. {ECO:0000269|PubMed:12490704}.
• Sequence:

  MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL

• Sequence length: 51

Pathways

Reactome:

L13a-mediated translational silencing of Ceruloplasmin expression
SRP-dependent cotranslational protein targeting to membrane
Viral mRNA Translation
Major pathway of rRNA processing in the nucleolus and cytosol
Formation of a pool of free 40S subunits
GTP hydrolysis and joining of the 60S ribosomal subunit
Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	39940786	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	24998577	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24452241		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19333399		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24452241		★☆☆☆☆ Found in Text Mining only