Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	116449
Gene name	Cytokine dependent hematopoietic cell linker
Gene symbol	CLNK
Synonyms (NCBI Gene)	MIST
Chromosome	4
Chromosome location	4p16.1
Summary	MIST is a member of the SLP76 family of adaptors (see LCP2, MIM 601603; BLNK, MIM 604515). MIST plays a role in the regulation of immunoreceptor signaling, including PLC-gamma (PLCG1; MIM 172420)-mediated B cell antigen receptor (BCR) signaling and FC-eps

131

Show/Hide all (131)

miRTarBase ID	miRNA	Experiments	Reference
MIRT650701	hsa-miR-548ac	HITS-CLIP	23824327
MIRT650700	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT650699	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT650698	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT650697	hsa-miR-548z	HITS-CLIP	23824327
MIRT650696	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT650695	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT650694	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT650693	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT650692	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT650691	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT650690	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT650689	hsa-miR-8485	HITS-CLIP	23824327
MIRT650688	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT621391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT621390	hsa-miR-4469	HITS-CLIP	23824327
MIRT621389	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621388	hsa-miR-4287	HITS-CLIP	23824327
MIRT621387	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT621386	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT621385	hsa-miR-3182	HITS-CLIP	23824327
MIRT621384	hsa-miR-3682-5p	HITS-CLIP	23824327
MIRT621383	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT621382	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT621381	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT621380	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT621379	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT621378	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT621377	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621376	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621375	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT650701	hsa-miR-548ac	HITS-CLIP	23824327
MIRT650700	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT650699	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT650698	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT650697	hsa-miR-548z	HITS-CLIP	23824327
MIRT650696	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT650695	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT650694	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT650693	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT650692	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT650691	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT650690	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT650689	hsa-miR-8485	HITS-CLIP	23824327
MIRT650688	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT621391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT621390	hsa-miR-4469	HITS-CLIP	23824327
MIRT621389	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621388	hsa-miR-4287	HITS-CLIP	23824327
MIRT621387	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT621386	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT621385	hsa-miR-3182	HITS-CLIP	23824327
MIRT621384	hsa-miR-3682-5p	HITS-CLIP	23824327
MIRT621383	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT621382	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT621381	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT621380	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT621379	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT621378	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT621377	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621376	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621375	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT650701	hsa-miR-548ac	HITS-CLIP	23824327
MIRT650700	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT650699	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT650698	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT650697	hsa-miR-548z	HITS-CLIP	23824327
MIRT650696	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT650695	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT650694	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT650693	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT650692	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT650691	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT650690	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT650689	hsa-miR-8485	HITS-CLIP	23824327
MIRT650688	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT621391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT621390	hsa-miR-4469	HITS-CLIP	23824327
MIRT621389	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621388	hsa-miR-4287	HITS-CLIP	23824327
MIRT621387	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT621386	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT621385	hsa-miR-3182	HITS-CLIP	23824327
MIRT621384	hsa-miR-3682-5p	HITS-CLIP	23824327
MIRT621383	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT621382	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT621381	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT621380	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT621379	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT621378	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT621377	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621376	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621375	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT650701	hsa-miR-548ac	HITS-CLIP	23824327
MIRT650700	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT650699	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT650698	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT650697	hsa-miR-548z	HITS-CLIP	23824327
MIRT650696	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT650695	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT650694	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT650693	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT650692	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT650691	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT650690	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT650689	hsa-miR-8485	HITS-CLIP	23824327
MIRT650688	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT621391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT621390	hsa-miR-4469	HITS-CLIP	23824327
MIRT621389	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621388	hsa-miR-4287	HITS-CLIP	23824327
MIRT621387	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT621386	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT621385	hsa-miR-3182	HITS-CLIP	23824327
MIRT621384	hsa-miR-3682-5p	HITS-CLIP	23824327
MIRT621383	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT621382	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT621381	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT621380	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT621379	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT621378	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT621377	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621376	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621375	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT897501	hsa-miR-124	CLIP-seq
MIRT897502	hsa-miR-4493	CLIP-seq
MIRT897503	hsa-miR-4635	CLIP-seq
MIRT897504	hsa-miR-506	CLIP-seq
MIRT2447208	hsa-miR-518e	CLIP-seq
MIRT2447209	hsa-miR-570	CLIP-seq
MIRT2447210	hsa-miR-671-5p	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002729	Process	Positive regulation of natural killer cell cytokine production	IEA
GO:0005515	Function	Protein binding	IPI	16273093, 26009488
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	26009488
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0032815	Process	Negative regulation of natural killer cell activation	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042629	Component	Mast cell granule	IEA
GO:0043303	Process	Mast cell degranulation	IEA
GO:0044877	Function	Protein-containing complex binding	IEA

MIM	HGNC	e!Ensembl
611434	17438	ENSG00000109684

Q7Z7G1

Protein name

Cytokine-dependent hematopoietic cell linker (Mast cell immunoreceptor signal transducer)

Protein function

An adapter protein which plays a role in the regulation of immunoreceptor signaling, including PLC-gamma-mediated B-cell antigen receptor (BCR) signaling and FC-epsilon R1-mediated mast cell degranulation (By similarity). Together with FGR, it a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	309 → 392	SH2 domain	Domain

Sequence

MNRQGNRKTTKEGSNDLKFQNFSLPKNRSWPRINSATGQYQRMNKPLLDWERNFAAVLDG
AKGHSDDDYDDPELRMEETWQSIKILPARPIKESEYADTHYFKVAMDTPLPLDTRTSISI
GQPTWNTQTRLERVDKPISKDVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPLPPEP
ESSRPPLSQRHTFPEVQRMPSQISLRDLSEVLEAEKVPHNQRKPESTHLLENQNTQEIPL
AISSSSFTTSNHSVQNRDHRGGMQPCSPQRCQPPASCSPHENILPYKYTSWRPPFPKRSD
RKDVQHNEWYIGEYSRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFYENKVYNVK
IRFLERNQQFALGTGLRGDEKFDSVEDIIEHYKNFPIILIDGKDKTGVHRKQCHLTQPLP
LTRHLLPL

Sequence length

428

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLNK-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ULCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC OSTEONECROSIS OF THE FEMORAL HEAD	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	20884846, 23263486	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21756847	★★★★★ ★☆☆☆☆ Found in Text Mining only
Foramen Ovale, Patent	Patent foramen ovale	BEFREE	28283958	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	20884846, 23263486	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21756847	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ostium secundum atrial septal defect	Secundum atrial septal defect	BEFREE	28283958	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24776764	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	CTD_human_DG	22561518	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

CLNK (cytokine dependent hematopoietic cell linker)