Gene Gene information from NCBI Gene database.
Entrez ID 116448
Gene name Oligodendrocyte transcription factor 1
Gene symbol OLIG1
Synonyms (NCBI Gene)
BHLHB6BHLHE21
Chromosome 21
Chromosome location 21q22.11
miRNA miRNA information provided by mirtarbase database.
47
miRTarBase ID miRNA Experiments Reference
MIRT1203286 hsa-miR-1181 CLIP-seq
MIRT1203287 hsa-miR-1207-3p CLIP-seq
MIRT1203288 hsa-miR-1262 CLIP-seq
MIRT1203289 hsa-miR-2110 CLIP-seq
MIRT1203290 hsa-miR-3150a-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 18923419, 25814554
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606385 16983 ENSG00000184221
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TAK6
Protein name Oligodendrocyte transcription factor 1 (Oligo1) (Class B basic helix-loop-helix protein 6) (bHLHb6) (Class E basic helix-loop-helix protein 21) (bHLHe21)
Protein function Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 106 165 Helix-loop-helix DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable. {ECO:0000269|PubMed:11526205}.
Sequence
MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSST
TAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQD
LNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLG
SSLQELRRALGEGAG
PAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAG
GPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
Sequence length 271
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anaplastic Oligodendroglioma Anaplastic Oligodendroglioma BEFREE 14575240
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms BEFREE 15164981
★☆☆☆☆
Found in Text Mining only
Cerebral Infarction Cerebral Infarction BEFREE 31702031
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 31848329
★☆☆☆☆
Found in Text Mining only
Down Syndrome Down syndrome Pubtator 30989628 Associate
★☆☆☆☆
Found in Text Mining only
Gilles de la Tourette syndrome Tourette Syndrome BEFREE 17283288
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma BEFREE 14730454, 15164981
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 22380883, 32999376 Associate
★☆☆☆☆
Found in Text Mining only
Glycogen Storage Disease Type III Glycogen Storage Disease BEFREE 19754354
★☆☆☆☆
Found in Text Mining only
Leukodystrophy Leukodystrophy BEFREE 17171653
★☆☆☆☆
Found in Text Mining only