GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A)

Gene

• Entrez ID: 116443
• Gene name: Glutamate ionotropic receptor NMDA type subunit 3A
• Gene symbol: GRIN3A
• Synonyms (NCBI Gene): GluN3A, NMDAR-L, NMDAR3A, NR3A
• Chromosome: 9
• Chromosome location: 9q31.1
• Summary: This gene encodes a subunit of the N-methyl-D-aspartate (NMDA) receptors, which belong to the superfamily of glutamate-regulated ion channels, and function in physiological and pathological processes in the central nervous system. This subunit shows great

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006066	hsa-miR-542-5p	Microarray, qRT-PCR	21310526
MIRT006066	hsa-miR-542-5p	Microarray, qRT-PCR	21310526
MIRT006066	hsa-miR-542-5p	Microarray, qRT-PCR	21310526
MIRT1034491	hsa-miR-1185	CLIP-seq
MIRT1034492	hsa-miR-1262	CLIP-seq
MIRT1034493	hsa-miR-1275	CLIP-seq
MIRT1034494	hsa-miR-1294	CLIP-seq
MIRT1034495	hsa-miR-134	CLIP-seq
MIRT1034496	hsa-miR-141	CLIP-seq
MIRT1034497	hsa-miR-199a-5p	CLIP-seq
MIRT1034498	hsa-miR-199b-5p	CLIP-seq
MIRT1034499	hsa-miR-200a	CLIP-seq
MIRT1034500	hsa-miR-2052	CLIP-seq
MIRT1034501	hsa-miR-2117	CLIP-seq
MIRT1034502	hsa-miR-2392	CLIP-seq
MIRT1034503	hsa-miR-28-3p	CLIP-seq
MIRT1034504	hsa-miR-29a	CLIP-seq
MIRT1034505	hsa-miR-29b	CLIP-seq
MIRT1034506	hsa-miR-29c	CLIP-seq
MIRT1034507	hsa-miR-3065-3p	CLIP-seq
MIRT1034508	hsa-miR-3118	CLIP-seq
MIRT1034509	hsa-miR-3187-3p	CLIP-seq
MIRT1034510	hsa-miR-3200-5p	CLIP-seq
MIRT1034511	hsa-miR-324-5p	CLIP-seq
MIRT1034512	hsa-miR-3605-5p	CLIP-seq
MIRT1034513	hsa-miR-3675-3p	CLIP-seq
MIRT1034514	hsa-miR-3679-5p	CLIP-seq
MIRT1034515	hsa-miR-376c	CLIP-seq
MIRT1034516	hsa-miR-3908	CLIP-seq
MIRT1034517	hsa-miR-409-3p	CLIP-seq
MIRT1034518	hsa-miR-4251	CLIP-seq
MIRT1034519	hsa-miR-4267	CLIP-seq
MIRT1034520	hsa-miR-4282	CLIP-seq
MIRT1034521	hsa-miR-4303	CLIP-seq
MIRT1034522	hsa-miR-4316	CLIP-seq
MIRT1034523	hsa-miR-4435	CLIP-seq
MIRT1034524	hsa-miR-4450	CLIP-seq
MIRT1034525	hsa-miR-4455	CLIP-seq
MIRT1034526	hsa-miR-4477a	CLIP-seq
MIRT1034527	hsa-miR-4481	CLIP-seq
MIRT1034528	hsa-miR-4522	CLIP-seq
MIRT1034529	hsa-miR-4525	CLIP-seq
MIRT1034530	hsa-miR-4665-5p	CLIP-seq
MIRT1034531	hsa-miR-4684-5p	CLIP-seq
MIRT1034532	hsa-miR-4701-3p	CLIP-seq
MIRT1034533	hsa-miR-4701-5p	CLIP-seq
MIRT1034534	hsa-miR-4723-5p	CLIP-seq
MIRT1034535	hsa-miR-4745-5p	CLIP-seq
MIRT1034536	hsa-miR-4758-5p	CLIP-seq
MIRT1034537	hsa-miR-4766-5p	CLIP-seq
MIRT1034538	hsa-miR-4793-5p	CLIP-seq
MIRT1034539	hsa-miR-498	CLIP-seq
MIRT1034540	hsa-miR-548p	CLIP-seq
MIRT1034541	hsa-miR-548s	CLIP-seq
MIRT1034542	hsa-miR-588	CLIP-seq
MIRT1034543	hsa-miR-590-3p	CLIP-seq
MIRT1034544	hsa-miR-609	CLIP-seq
MIRT1034545	hsa-miR-625	CLIP-seq
MIRT1034546	hsa-miR-944	CLIP-seq
MIRT1034496	hsa-miR-141	CLIP-seq
MIRT2006812	hsa-miR-146a	CLIP-seq
MIRT2006813	hsa-miR-146b-5p	CLIP-seq
MIRT1034499	hsa-miR-200a	CLIP-seq
MIRT2006814	hsa-miR-342-5p	CLIP-seq
MIRT2006815	hsa-miR-3671	CLIP-seq
MIRT1034513	hsa-miR-3675-3p	CLIP-seq
MIRT2006816	hsa-miR-4651	CLIP-seq
MIRT2006817	hsa-miR-4664-5p	CLIP-seq
MIRT2006818	hsa-miR-580	CLIP-seq
MIRT2006819	hsa-miR-589	CLIP-seq
MIRT1034543	hsa-miR-590-3p	CLIP-seq
MIRT2006820	hsa-miR-607	CLIP-seq
MIRT2006821	hsa-miR-608	CLIP-seq
MIRT1034493	hsa-miR-1275	CLIP-seq
MIRT2006812	hsa-miR-146a	CLIP-seq
MIRT2006813	hsa-miR-146b-5p	CLIP-seq
MIRT2239278	hsa-miR-3140-3p	CLIP-seq
MIRT2006815	hsa-miR-3671	CLIP-seq
MIRT2239279	hsa-miR-375	CLIP-seq
MIRT2239280	hsa-miR-3919	CLIP-seq
MIRT2239281	hsa-miR-4254	CLIP-seq
MIRT2239282	hsa-miR-4273	CLIP-seq
MIRT2239283	hsa-miR-4422	CLIP-seq
MIRT1034524	hsa-miR-4450	CLIP-seq
MIRT1034530	hsa-miR-4665-5p	CLIP-seq
MIRT2239284	hsa-miR-4677-5p	CLIP-seq
MIRT1034537	hsa-miR-4766-5p	CLIP-seq
MIRT2006818	hsa-miR-580	CLIP-seq
MIRT2006819	hsa-miR-589	CLIP-seq
MIRT2006820	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004970	Function	Glutamate-gated receptor activity	IEA
GO:0004972	Function	NMDA glutamate receptor activity	IDA	17502428
GO:0004972	Function	NMDA glutamate receptor activity	IEA
GO:0004972	Function	NMDA glutamate receptor activity	ISS
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005262	Function	Calcium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	17658481, 17997397
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	ISS
GO:0008066	Function	Glutamate receptor activity	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0015276	Function	Ligand-gated monoatomic ion channel activity	IEA
GO:0016020	Component	Membrane	IDA	17997397
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11880201
GO:0016358	Process	Dendrite development	IEA
GO:0016594	Function	Glycine binding	IDA	17320117
GO:0016594	Function	Glycine binding	IEA
GO:0017146	Component	NMDA selective glutamate receptor complex	IDA	17997397
GO:0017146	Component	NMDA selective glutamate receptor complex	IEA
GO:0022824	Function	Transmitter-gated monoatomic ion channel activity	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IDA	38598639
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	IBA
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	IEA
GO:0035249	Process	Synaptic transmission, glutamatergic	IBA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0042802	Function	Identical protein binding	IPI	17997397
GO:0043005	Component	Neuron projection	IDA	17658481
GO:0043025	Component	Neuronal cell body	IDA	17658481
GO:0043025	Component	Neuronal cell body	IEA
GO:0043226	Component	Organelle	IEA
GO:0045202	Component	Synapse	IDA	17658481
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045211	Component	Postsynaptic membrane	ISS
GO:0045471	Process	Response to ethanol	IDA	17502428, 18445116
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0048666	Process	Neuron development	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA
GO:0051721	Function	Protein phosphatase 2A binding	IEA
GO:0051721	Function	Protein phosphatase 2A binding	ISS
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060134	Process	Prepulse inhibition	IEA
GO:0061000	Process	Negative regulation of dendritic spine development	IEA
GO:0061000	Process	Negative regulation of dendritic spine development	ISS
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070905	Function	Serine binding	IEA
GO:0070905	Function	Serine binding	ISS
GO:0098655	Process	Monoatomic cation transmembrane transport	IEA
GO:0098655	Process	Monoatomic cation transmembrane transport	ISS
GO:0098655	Process	Monoatomic cation transmembrane transport	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IBA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098878	Component	Neurotransmitter receptor complex	IDA	38598639
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:0160212	Function	Glycine-gated cation channel activity	ISS
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IEA

Other IDs

• MIM: 606650
• HGNC: 16767
• e!Ensembl: ENSG00000198785

Protein

• UniProt ID: Q8TCU5
• Protein name: Glutamate receptor ionotropic, NMDA 3A (GluN3A) (N-methyl-D-aspartate receptor subtype 3A) (NMDAR3A) (NR3A) (NMDAR-L)
• Protein function: Component of a non-conventional N-methyl-D-aspartate (NMDA) receptors (NMDARs) that function as heterotetrameric, ligand-gated cation channels with low calcium permeability and low voltage-dependent block by Mg(2+) (By similarity). During the de
• PDB: 8USW, 8USX, 8UUE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10613	Lig_chan-Glu_bd	557 → 661	Ligated ion channel L-glutamate- and glycine-binding site	Domain
  PF00060	Lig_chan	674 → 942	Ligand-gated ion channel	Family

• Sequence:

  MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
  APRAASRAPDDSRAGAQRDEPEPGTRRSPAPSPGARWLGSTLHGRGPPGSRKPGEGARAE
  ALWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
  LQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSLVLHIPVISIVRHEFPRESQNPLHLQL
  SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITAN
  LPSTQDLLSFLQIQLESIKNSTPTVVMFGCDMESIRRIFEITTQFGVMPPELRWVLGDSQ
  NVEELRTEGLPLGLIAHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCM
  EVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIVSSENNFFIWNLQHDPMGKPMWTR
  LGSWQGGKIVMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAG
  QLCLDPMTNDSSTLDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIV
  GDGKYGAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
  DTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSAL
  NICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
  HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLD
  AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFM
  DMLHDKWYRVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLL
  PRIKNKSKLQYWLHTSQRLHRAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLS
  HDNRRKYIFSDEEGQNQLGIRIHQDIPLPPRRRELPALRTTNGKADSLNVSRNSVMQELS
  ELEKQIQVIRQELQLAVSRKTELEEYQRTSRTCES

• Sequence length: 1115

Pathways

KEGG:

Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Spinocerebellar ataxia
Prion disease
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism

Reactome:

Assembly and cell surface presentation of NMDA receptors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL LUNG DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	24278430		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30734226		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15474907		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	15474907		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	19488045	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Palsy	Cerebral palsy	BEFREE	22914463		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	22914463	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	29915530		★☆☆☆☆ Found in Text Mining only
Congenital macrodactylia	Congenital macrodactylia	BEFREE	27840953		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	24278430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Aneurysm	Coronary aneurysm	Pubtator	24278430	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delirium	Delirium	BEFREE	25041634		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	CTD_human_DG	19295509		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	BEFREE	25686081, 29914757		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	22914463	Associate	★☆☆☆☆ Found in Text Mining only
Leukomalacia Periventricular	Periventricular leukomalacia	Pubtator	24046081	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	24278430		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	24278430	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	20097255		★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	26265699	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15474907, 19665356, 23237318, 26257337		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15474907, 19665356, 23237318		★★☆☆☆ Found in Text Mining + Unknown/Other Associations