Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1164
Gene name	CDC28 protein kinase regulatory subunit 2
Gene symbol	CKS2
Synonyms (NCBI Gene)	CKSHS2
Chromosome	9
Chromosome location	9q22.2
Summary	CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role

242

Show/Hide all (242)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022264	hsa-miR-124-3p	Microarray	18668037
MIRT052270	hsa-let-7b-5p	CLASH	23622248
MIRT053077	hsa-miR-26a-5p	FlowWestern blot	23861775
MIRT325435	hsa-miR-548ae-3p	HITS-CLIP	19536157
MIRT325436	hsa-miR-548ah-3p	HITS-CLIP	19536157
MIRT325437	hsa-miR-548aj-3p	HITS-CLIP	19536157
MIRT325438	hsa-miR-548am-3p	HITS-CLIP	19536157
MIRT325439	hsa-miR-548aq-3p	HITS-CLIP	19536157
MIRT325429	hsa-miR-548j-3p	HITS-CLIP	19536157
MIRT325432	hsa-miR-548x-3p	HITS-CLIP	19536157
MIRT325425	hsa-miR-548a-3p	HITS-CLIP	19536157
MIRT325440	hsa-miR-548ar-3p	HITS-CLIP	19536157
MIRT325441	hsa-miR-548az-3p	HITS-CLIP	19536157
MIRT325428	hsa-miR-548e-3p	HITS-CLIP	19536157
MIRT325430	hsa-miR-548f-3p	HITS-CLIP	19536157
MIRT723705	hsa-miR-4511	HITS-CLIP	19536157
MIRT723704	hsa-miR-200a-5p	HITS-CLIP	19536157
MIRT723703	hsa-miR-200b-5p	HITS-CLIP	19536157
MIRT723702	hsa-miR-4269	HITS-CLIP	19536157
MIRT723701	hsa-miR-6715b-5p	HITS-CLIP	19536157
MIRT723700	hsa-miR-302a-5p	HITS-CLIP	19536157
MIRT723699	hsa-miR-7-5p	HITS-CLIP	19536157
MIRT723698	hsa-miR-6077	HITS-CLIP	19536157
MIRT479232	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT479231	hsa-miR-1246	PAR-CLIP	20371350
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	20371350
MIRT479228	hsa-miR-1255a	PAR-CLIP	20371350
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	20371350
MIRT479221	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT479219	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT479218	hsa-miR-574-3p	PAR-CLIP	20371350
MIRT479232	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT479231	hsa-miR-1246	PAR-CLIP	20371350
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	20371350
MIRT479228	hsa-miR-1255a	PAR-CLIP	20371350
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	20371350
MIRT479221	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT479219	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT479218	hsa-miR-574-3p	PAR-CLIP	20371350
MIRT479232	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT479231	hsa-miR-1246	PAR-CLIP	20371350
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	20371350
MIRT479228	hsa-miR-1255a	PAR-CLIP	20371350
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	20371350
MIRT479221	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT479219	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT479218	hsa-miR-574-3p	PAR-CLIP	20371350
MIRT479232	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT479231	hsa-miR-1246	PAR-CLIP	23446348
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	23446348
MIRT479228	hsa-miR-1255a	PAR-CLIP	23446348
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	23446348
MIRT479221	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT479219	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT479218	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT479232	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT479231	hsa-miR-1246	PAR-CLIP	23446348
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	23446348
MIRT479228	hsa-miR-1255a	PAR-CLIP	23446348
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	23446348
MIRT479221	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT479219	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT479218	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT479232	hsa-miR-493-5p	PAR-CLIP	23592263
MIRT479231	hsa-miR-1246	PAR-CLIP	23592263
MIRT479230	hsa-miR-5697	PAR-CLIP	23592263
MIRT365388	hsa-miR-6847-3p	PAR-CLIP	23592263
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	23592263
MIRT479228	hsa-miR-1255a	PAR-CLIP	23592263
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT479226	hsa-miR-1297	PAR-CLIP	23592263
MIRT053077	hsa-miR-26a-5p	PAR-CLIP	23592263
MIRT479225	hsa-miR-26b-5p	PAR-CLIP	23592263
MIRT479223	hsa-miR-4465	PAR-CLIP	23592263
MIRT479224	hsa-miR-513c-5p	PAR-CLIP	23592263
MIRT479222	hsa-miR-514b-5p	PAR-CLIP	23592263
MIRT479221	hsa-let-7c-3p	PAR-CLIP	23592263
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT479219	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT479218	hsa-miR-574-3p	PAR-CLIP	23592263
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	26701625
MIRT479221	hsa-let-7c-3p	PAR-CLIP	26701625
MIRT479219	hsa-let-7g-3p	PAR-CLIP	26701625
MIRT479231	hsa-miR-1246	PAR-CLIP	26701625
MIRT479228	hsa-miR-1255a	PAR-CLIP	26701625
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	26701625
MIRT479232	hsa-miR-493-5p	PAR-CLIP	26701625
MIRT479218	hsa-miR-574-3p	PAR-CLIP	26701625
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	26701625
MIRT053077	hsa-miR-26a-5p	Western blottingqRT-PCR	32426838
MIRT325435	hsa-miR-548ae-3p	HITS-CLIP	19536157
MIRT325436	hsa-miR-548ah-3p	HITS-CLIP	19536157
MIRT325437	hsa-miR-548aj-3p	HITS-CLIP	19536157
MIRT325438	hsa-miR-548am-3p	HITS-CLIP	19536157
MIRT325439	hsa-miR-548aq-3p	HITS-CLIP	19536157
MIRT325429	hsa-miR-548j-3p	HITS-CLIP	19536157
MIRT325432	hsa-miR-548x-3p	HITS-CLIP	19536157
MIRT325425	hsa-miR-548a-3p	HITS-CLIP	19536157
MIRT325440	hsa-miR-548ar-3p	HITS-CLIP	19536157
MIRT325441	hsa-miR-548az-3p	HITS-CLIP	19536157
MIRT325428	hsa-miR-548e-3p	HITS-CLIP	19536157
MIRT325430	hsa-miR-548f-3p	HITS-CLIP	19536157
MIRT723705	hsa-miR-4511	HITS-CLIP	19536157
MIRT723704	hsa-miR-200a-5p	HITS-CLIP	19536157
MIRT723703	hsa-miR-200b-5p	HITS-CLIP	19536157
MIRT723702	hsa-miR-4269	HITS-CLIP	19536157
MIRT723701	hsa-miR-6715b-5p	HITS-CLIP	19536157
MIRT723700	hsa-miR-302a-5p	HITS-CLIP	19536157
MIRT723699	hsa-miR-7-5p	HITS-CLIP	19536157
MIRT723698	hsa-miR-6077	HITS-CLIP	19536157
MIRT479232	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT479231	hsa-miR-1246	PAR-CLIP	20371350
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	20371350
MIRT479228	hsa-miR-1255a	PAR-CLIP	20371350
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	20371350
MIRT479221	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT479219	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT479218	hsa-miR-574-3p	PAR-CLIP	20371350
MIRT479232	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT479231	hsa-miR-1246	PAR-CLIP	20371350
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	20371350
MIRT479228	hsa-miR-1255a	PAR-CLIP	20371350
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	20371350
MIRT479221	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT479219	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT479218	hsa-miR-574-3p	PAR-CLIP	20371350
MIRT479232	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT479231	hsa-miR-1246	PAR-CLIP	20371350
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	20371350
MIRT479228	hsa-miR-1255a	PAR-CLIP	20371350
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	20371350
MIRT479221	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT479219	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT479218	hsa-miR-574-3p	PAR-CLIP	20371350
MIRT479232	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT479231	hsa-miR-1246	PAR-CLIP	23446348
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	23446348
MIRT479228	hsa-miR-1255a	PAR-CLIP	23446348
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	23446348
MIRT479221	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT479219	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT479218	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT479232	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT479231	hsa-miR-1246	PAR-CLIP	23446348
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	23446348
MIRT479228	hsa-miR-1255a	PAR-CLIP	23446348
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	23446348
MIRT479221	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT479219	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT479218	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT479232	hsa-miR-493-5p	PAR-CLIP	23592263
MIRT479231	hsa-miR-1246	PAR-CLIP	23592263
MIRT479230	hsa-miR-5697	PAR-CLIP	23592263
MIRT365388	hsa-miR-6847-3p	PAR-CLIP	23592263
MIRT479229	hsa-miR-6744-5p	PAR-CLIP	23592263
MIRT479228	hsa-miR-1255a	PAR-CLIP	23592263
MIRT479227	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT479226	hsa-miR-1297	PAR-CLIP	23592263
MIRT053077	hsa-miR-26a-5p	PAR-CLIP	23592263
MIRT479225	hsa-miR-26b-5p	PAR-CLIP	23592263
MIRT479223	hsa-miR-4465	PAR-CLIP	23592263
MIRT479224	hsa-miR-513c-5p	PAR-CLIP	23592263
MIRT479222	hsa-miR-514b-5p	PAR-CLIP	23592263
MIRT479221	hsa-let-7c-3p	PAR-CLIP	23592263
MIRT479220	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT479219	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT479218	hsa-miR-574-3p	PAR-CLIP	23592263
MIRT894285	hsa-miR-101	CLIP-seq
MIRT894286	hsa-miR-1255b	CLIP-seq
MIRT894287	hsa-miR-1267	CLIP-seq
MIRT894288	hsa-miR-144	CLIP-seq
MIRT894289	hsa-miR-2355-5p	CLIP-seq
MIRT894290	hsa-miR-26a	CLIP-seq
MIRT894291	hsa-miR-26b	CLIP-seq
MIRT894292	hsa-miR-3185	CLIP-seq
MIRT894293	hsa-miR-323-3p	CLIP-seq
MIRT894294	hsa-miR-33a	CLIP-seq
MIRT894295	hsa-miR-33b	CLIP-seq
MIRT894296	hsa-miR-3611	CLIP-seq
MIRT894297	hsa-miR-3670	CLIP-seq
MIRT894298	hsa-miR-4420	CLIP-seq
MIRT894299	hsa-miR-4427	CLIP-seq
MIRT894300	hsa-miR-4643	CLIP-seq
MIRT894301	hsa-miR-466	CLIP-seq
MIRT894302	hsa-miR-4789-3p	CLIP-seq
MIRT894303	hsa-miR-4789-5p	CLIP-seq
MIRT894304	hsa-miR-513c	CLIP-seq
MIRT894305	hsa-miR-577	CLIP-seq
MIRT894306	hsa-miR-582-5p	CLIP-seq
MIRT894307	hsa-miR-600	CLIP-seq
MIRT894308	hsa-miR-7	CLIP-seq
MIRT894285	hsa-miR-101	CLIP-seq
MIRT894286	hsa-miR-1255b	CLIP-seq
MIRT894287	hsa-miR-1267	CLIP-seq
MIRT894288	hsa-miR-144	CLIP-seq
MIRT894290	hsa-miR-26a	CLIP-seq
MIRT894291	hsa-miR-26b	CLIP-seq
MIRT894292	hsa-miR-3185	CLIP-seq
MIRT894293	hsa-miR-323-3p	CLIP-seq
MIRT894294	hsa-miR-33a	CLIP-seq
MIRT894295	hsa-miR-33b	CLIP-seq
MIRT894296	hsa-miR-3611	CLIP-seq
MIRT894297	hsa-miR-3670	CLIP-seq
MIRT894298	hsa-miR-4420	CLIP-seq
MIRT894299	hsa-miR-4427	CLIP-seq
MIRT894300	hsa-miR-4643	CLIP-seq
MIRT894301	hsa-miR-466	CLIP-seq
MIRT894302	hsa-miR-4789-3p	CLIP-seq
MIRT894303	hsa-miR-4789-5p	CLIP-seq
MIRT1965166	hsa-miR-513a-3p	CLIP-seq
MIRT894304	hsa-miR-513c	CLIP-seq
MIRT1965167	hsa-miR-548ae	CLIP-seq
MIRT1965168	hsa-miR-548aj	CLIP-seq
MIRT1965169	hsa-miR-548am	CLIP-seq
MIRT1965170	hsa-miR-548e	CLIP-seq
MIRT1965171	hsa-miR-548f	CLIP-seq
MIRT1965172	hsa-miR-548x	CLIP-seq
MIRT894306	hsa-miR-582-5p	CLIP-seq
MIRT894307	hsa-miR-600	CLIP-seq
MIRT894308	hsa-miR-7	CLIP-seq
MIRT894286	hsa-miR-1255b	CLIP-seq
MIRT2201146	hsa-miR-371-5p	CLIP-seq
MIRT1965167	hsa-miR-548ae	CLIP-seq
MIRT1965168	hsa-miR-548aj	CLIP-seq
MIRT1965169	hsa-miR-548am	CLIP-seq
MIRT1965170	hsa-miR-548e	CLIP-seq
MIRT1965171	hsa-miR-548f	CLIP-seq
MIRT1965172	hsa-miR-548x	CLIP-seq
MIRT894308	hsa-miR-7	CLIP-seq
MIRT2201147	hsa-miR-888	CLIP-seq
MIRT894286	hsa-miR-1255b	CLIP-seq
MIRT894292	hsa-miR-3185	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
YBX1	Repression	20596676

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	2227411, 28514442, 32296183, 33961781
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007127	Process	Meiosis I	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IBA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0019901	Function	Protein kinase binding	IBA
GO:0042393	Function	Histone binding	IBA
GO:0043130	Function	Ubiquitin binding	IBA
GO:0044772	Process	Mitotic cell cycle phase transition	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0051301	Process	Cell division	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IBA

MIM	HGNC	e!Ensembl
116901	2000	ENSG00000123975

P33552

Protein name

Cyclin-dependent kinases regulatory subunit 2 (CKS-2)

Protein function

Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.

PDB

1CKS , 4Y72 , 4YC3 , 5HQ0 , 5LQF , 6GU2 , 6GU3 , 6GU4 , 6GU6 , 6GU7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01111	CKS	6 → 73	Cyclin-dependent kinase regulatory subunit	Domain

Sequence

MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH
EPEPHILLFRRPLPKDQQK

Sequence length

Interactions

View interactions

	KEGG
	Pathways in cancer Small cell lung cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (67)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10360827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33667214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10360827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35789606	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35844557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	34494924	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16865252, 20920335, 21672358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	18005268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30957190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25674223, 33066779, 33959662, 36284444, 37958803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20920335, 36284444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19845855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26531156, 31781310, 33390802, 36284444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16865252, 20920335, 21672358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31081074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35059737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31081074		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30856376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30856376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10360827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23121546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19845855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21304002, 26156959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36123948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35693634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31081074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23301842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23301842, 32426838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34494924, 36284444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35663965	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30856376	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	29143362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	31452763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19845855, 23301842, 26531156, 29487004, 30129142, 31781310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19845855, 31781310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	31781310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35693634	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35703112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30957190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18498131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19034516, 21617860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16865252, 20920335, 21672358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19845855, 21304002, 23301842, 24604089, 29764514, 30957190, 31781310, 31788116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30856376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15900300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	21948653, 22964784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	21948653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	18005268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14719106, 18498131, 19034516, 21304002, 21617860, 21672358, 21948653, 24604089, 29383129, 29487004, 30856376, 30957190, 31081074, 31452763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29760609, 35410253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33370338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29764514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23861775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10360827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18498131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24604089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31391008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19034516, 21617860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35703112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20920335	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21672358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35703112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17054779, 30856376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	31452763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	36401415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CKS2 (CDC28 protein kinase regulatory subunit 2)