IL22RA2 (interleukin 22 receptor subunit alpha 2)

Gene

• Entrez ID: 116379
• Gene name: Interleukin 22 receptor subunit alpha 2
• Gene symbol: IL22RA2
• Synonyms (NCBI Gene): CRF2-10, CRF2-S1, CRF2X, IL-22BP, IL-22R-alpha-2, IL-22RA2, ZCYTOR16
• Chromosome: 6
• Chromosome location: 6q23.3
• Summary: This gene encodes a member of the class II cytokine receptor family. The encoded soluble protein specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor. The encoded protein m

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1064592	hsa-miR-224	CLIP-seq
MIRT1064593	hsa-miR-3155	CLIP-seq
MIRT1064594	hsa-miR-3155b	CLIP-seq
MIRT1064595	hsa-miR-4436a	CLIP-seq
MIRT1064596	hsa-miR-4477a	CLIP-seq
MIRT1064597	hsa-miR-4759	CLIP-seq
MIRT1064598	hsa-miR-484	CLIP-seq
MIRT1064599	hsa-miR-1261	CLIP-seq
MIRT1064600	hsa-miR-186	CLIP-seq
MIRT1064601	hsa-miR-1	CLIP-seq
MIRT1064602	hsa-miR-206	CLIP-seq
MIRT1064603	hsa-miR-3671	CLIP-seq
MIRT1064604	hsa-miR-4325	CLIP-seq
MIRT1064605	hsa-miR-450b-5p	CLIP-seq
MIRT1064606	hsa-miR-496	CLIP-seq
MIRT1064607	hsa-miR-507	CLIP-seq
MIRT1064608	hsa-miR-557	CLIP-seq
MIRT1064609	hsa-miR-587	CLIP-seq
MIRT1064610	hsa-miR-607	CLIP-seq
MIRT1064611	hsa-miR-613	CLIP-seq
MIRT1064612	hsa-miR-625	CLIP-seq
MIRT2247680	hsa-miR-3185	CLIP-seq
MIRT2247681	hsa-miR-3714	CLIP-seq
MIRT2451747	hsa-miR-4279	CLIP-seq
MIRT2451748	hsa-miR-4691-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	NAS	11390453, 11390454
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0042017	Function	Interleukin-22 binding	IDA	11390453
GO:0042018	Function	Interleukin-22 receptor activity	IDA	11390454
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0140865	Process	Interleukin-22-mediated signaling pathway	IEA

Other IDs

• MIM: 606648
• HGNC: 14901
• e!Ensembl: ENSG00000164485

Protein

• UniProt ID: Q969J5
• Protein name: Interleukin-22 receptor subunit alpha-2 (IL-22 receptor subunit alpha-2) (IL-22R-alpha-2) (IL-22RA2) (Cytokine receptor class-II member 10) (Cytokine receptor family 2 member 10) (CRF2-10) (Cytokine receptor family type 2, soluble 1) (CRF2-S1) (Interleuki
• Protein function: Isoform 2 is a receptor for IL22. Binds to IL22, prevents interaction with the functional IL-22R complex and blocks the activity of IL22 (in vitro). May play an important role as an IL22 antagonist in the regulation of inflammatory responses.; F
• PDB: 3G9V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01108	Tissue_fac	7 → 146	Tissue factor	Family
  PF09294	Interfer-bind	158 → 263	Interferon-alpha/beta receptor, fibronectin type III	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in placenta, spleen, breast, skin and lung. Also detected in intestinal tract, testis, brain, heart and thymus. No expression found in prostate, bladder, kidney, ovary, muscle, bone marrow, liver and uterus. Isoform 1 is expr
• Sequence:

  MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVY
  FVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDL
  TSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHA
  PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVV
  AEIYQPMLDRRSQRSEERCVEIP

• Sequence length: 263

Pathways

KEGG:

JAK-STAT signaling pathway

Reactome:

Interleukin-20 family signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multisystem inflammatory syndrome in children	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSIENT ISCHEMIC ATTACK	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	34995380	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24638856, 29572462		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26329427, 28579463		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	34992594	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	35383266	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29944098		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38164262	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28356382, 29977242		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28356382, 29572462		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28450947		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26329427, 31131860		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31131860, 35383266	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28356382, 29977242		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28887660		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28887660		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29944098		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21041731, 24638856, 31292217		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	26077779, 31936765	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	24599919	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29080226		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	29977242		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28356382, 29572462		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30899399		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	25880879	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	30352204	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	22333690		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	22333690		★☆☆☆☆ Found in Text Mining only