Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	116255
Gene name	Monoacylglycerol O-acyltransferase 1
Gene symbol	MOGAT1
Synonyms (NCBI Gene)	DGAT2LDGAT2L1MGAT1
Chromosome	2
Chromosome location	2q36.1
Summary	Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM,

141

Show/Hide all (141)

miRTarBase ID	miRNA	Experiments	Reference
MIRT723305	hsa-miR-1245a	HITS-CLIP	19536157
MIRT723304	hsa-miR-8079	HITS-CLIP	19536157
MIRT723303	hsa-miR-3140-5p	HITS-CLIP	19536157
MIRT723302	hsa-miR-371b-5p	HITS-CLIP	19536157
MIRT723301	hsa-miR-373-5p	HITS-CLIP	19536157
MIRT723300	hsa-miR-616-5p	HITS-CLIP	19536157
MIRT723299	hsa-miR-371a-5p	HITS-CLIP	19536157
MIRT723298	hsa-miR-372-5p	HITS-CLIP	19536157
MIRT723297	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT723296	hsa-miR-3663-5p	HITS-CLIP	19536157
MIRT723295	hsa-miR-4795-5p	HITS-CLIP	19536157
MIRT723294	hsa-miR-6131	HITS-CLIP	19536157
MIRT723293	hsa-miR-3616-5p	HITS-CLIP	19536157
MIRT723292	hsa-miR-573	HITS-CLIP	19536157
MIRT723291	hsa-miR-6843-3p	HITS-CLIP	19536157
MIRT723290	hsa-miR-6848-3p	HITS-CLIP	19536157
MIRT718301	hsa-miR-3714	HITS-CLIP	19536157
MIRT718300	hsa-miR-3607-3p	HITS-CLIP	19536157
MIRT718299	hsa-miR-4708-3p	HITS-CLIP	19536157
MIRT718298	hsa-miR-4660	HITS-CLIP	19536157
MIRT718297	hsa-miR-30a-5p	HITS-CLIP	19536157
MIRT718296	hsa-miR-30b-5p	HITS-CLIP	19536157
MIRT718295	hsa-miR-30c-5p	HITS-CLIP	19536157
MIRT718294	hsa-miR-30d-5p	HITS-CLIP	19536157
MIRT718293	hsa-miR-30e-5p	HITS-CLIP	19536157
MIRT718292	hsa-miR-3686	HITS-CLIP	19536157
MIRT702038	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT702037	hsa-miR-4438	HITS-CLIP	23313552
MIRT702036	hsa-miR-455-5p	HITS-CLIP	23313552
MIRT702035	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT702034	hsa-miR-500b-3p	HITS-CLIP	23313552
MIRT702033	hsa-miR-4735-5p	HITS-CLIP	23313552
MIRT702032	hsa-miR-6128	HITS-CLIP	23313552
MIRT702031	hsa-miR-1227-3p	HITS-CLIP	23313552
MIRT702030	hsa-miR-4775	HITS-CLIP	23313552
MIRT702029	hsa-miR-5095	HITS-CLIP	23313552
MIRT702028	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT702027	hsa-miR-4715-3p	HITS-CLIP	23313552
MIRT702026	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT675148	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT675147	hsa-miR-3194-3p	HITS-CLIP	23313552
MIRT675146	hsa-miR-3135b	HITS-CLIP	23313552
MIRT675145	hsa-miR-504-3p	HITS-CLIP	23313552
MIRT675144	hsa-miR-122-5p	HITS-CLIP	23313552
MIRT675143	hsa-miR-3652	HITS-CLIP	23313552
MIRT675142	hsa-miR-4430	HITS-CLIP	23313552
MIRT675137	hsa-miR-5698	HITS-CLIP	23313552
MIRT675141	hsa-miR-143-5p	HITS-CLIP	23313552
MIRT675140	hsa-miR-5691	HITS-CLIP	23313552
MIRT675139	hsa-miR-6805-3p	HITS-CLIP	23313552
MIRT675149	hsa-miR-432-5p	HITS-CLIP	23824327
MIRT675148	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT675147	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT675146	hsa-miR-3135b	HITS-CLIP	23824327
MIRT675145	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT675144	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT675143	hsa-miR-3652	HITS-CLIP	23824327
MIRT675142	hsa-miR-4430	HITS-CLIP	23824327
MIRT675141	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT675140	hsa-miR-5691	HITS-CLIP	23824327
MIRT675139	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT675138	hsa-miR-5004-3p	HITS-CLIP	23824327
MIRT675137	hsa-miR-5698	HITS-CLIP	23824327
MIRT535962	hsa-miR-511-3p	PAR-CLIP	22012620
MIRT535961	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT535960	hsa-miR-619-5p	PAR-CLIP	22012620
MIRT535959	hsa-miR-6506-5p	PAR-CLIP	22012620
MIRT535958	hsa-miR-4252	PAR-CLIP	22012620
MIRT535957	hsa-miR-4666a-5p	PAR-CLIP	22012620
MIRT535956	hsa-miR-5089-5p	PAR-CLIP	22012620
MIRT723305	hsa-miR-1245a	HITS-CLIP	19536157
MIRT723304	hsa-miR-8079	HITS-CLIP	19536157
MIRT723303	hsa-miR-3140-5p	HITS-CLIP	19536157
MIRT723302	hsa-miR-371b-5p	HITS-CLIP	19536157
MIRT723301	hsa-miR-373-5p	HITS-CLIP	19536157
MIRT723300	hsa-miR-616-5p	HITS-CLIP	19536157
MIRT723299	hsa-miR-371a-5p	HITS-CLIP	19536157
MIRT723298	hsa-miR-372-5p	HITS-CLIP	19536157
MIRT723297	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT723296	hsa-miR-3663-5p	HITS-CLIP	19536157
MIRT723295	hsa-miR-4795-5p	HITS-CLIP	19536157
MIRT723294	hsa-miR-6131	HITS-CLIP	19536157
MIRT723293	hsa-miR-3616-5p	HITS-CLIP	19536157
MIRT723292	hsa-miR-573	HITS-CLIP	19536157
MIRT723291	hsa-miR-6843-3p	HITS-CLIP	19536157
MIRT723290	hsa-miR-6848-3p	HITS-CLIP	19536157
MIRT718301	hsa-miR-3714	HITS-CLIP	19536157
MIRT718300	hsa-miR-3607-3p	HITS-CLIP	19536157
MIRT718299	hsa-miR-4708-3p	HITS-CLIP	19536157
MIRT718298	hsa-miR-4660	HITS-CLIP	19536157
MIRT718297	hsa-miR-30a-5p	HITS-CLIP	19536157
MIRT718296	hsa-miR-30b-5p	HITS-CLIP	19536157
MIRT718295	hsa-miR-30c-5p	HITS-CLIP	19536157
MIRT718294	hsa-miR-30d-5p	HITS-CLIP	19536157
MIRT718293	hsa-miR-30e-5p	HITS-CLIP	19536157
MIRT718292	hsa-miR-3686	HITS-CLIP	19536157
MIRT702038	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT702037	hsa-miR-4438	HITS-CLIP	23313552
MIRT702036	hsa-miR-455-5p	HITS-CLIP	23313552
MIRT702035	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT702034	hsa-miR-500b-3p	HITS-CLIP	23313552
MIRT702033	hsa-miR-4735-5p	HITS-CLIP	23313552
MIRT702032	hsa-miR-6128	HITS-CLIP	23313552
MIRT702031	hsa-miR-1227-3p	HITS-CLIP	23313552
MIRT702030	hsa-miR-4775	HITS-CLIP	23313552
MIRT702029	hsa-miR-5095	HITS-CLIP	23313552
MIRT702028	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT702027	hsa-miR-4715-3p	HITS-CLIP	23313552
MIRT702026	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT675148	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT675147	hsa-miR-3194-3p	HITS-CLIP	23313552
MIRT675146	hsa-miR-3135b	HITS-CLIP	23313552
MIRT675145	hsa-miR-504-3p	HITS-CLIP	23313552
MIRT675144	hsa-miR-122-5p	HITS-CLIP	23313552
MIRT675143	hsa-miR-3652	HITS-CLIP	23313552
MIRT675142	hsa-miR-4430	HITS-CLIP	23313552
MIRT675137	hsa-miR-5698	HITS-CLIP	23313552
MIRT675141	hsa-miR-143-5p	HITS-CLIP	23313552
MIRT675140	hsa-miR-5691	HITS-CLIP	23313552
MIRT675139	hsa-miR-6805-3p	HITS-CLIP	23313552
MIRT675149	hsa-miR-432-5p	HITS-CLIP	23824327
MIRT675148	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT675147	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT675146	hsa-miR-3135b	HITS-CLIP	23824327
MIRT675145	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT675144	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT675143	hsa-miR-3652	HITS-CLIP	23824327
MIRT675142	hsa-miR-4430	HITS-CLIP	23824327
MIRT675141	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT675140	hsa-miR-5691	HITS-CLIP	23824327
MIRT675139	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT675138	hsa-miR-5004-3p	HITS-CLIP	23824327
MIRT675137	hsa-miR-5698	HITS-CLIP	23824327
MIRT535962	hsa-miR-511-3p	PAR-CLIP	22012620
MIRT535961	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT535960	hsa-miR-619-5p	PAR-CLIP	22012620
MIRT535959	hsa-miR-6506-5p	PAR-CLIP	22012620
MIRT535958	hsa-miR-4252	PAR-CLIP	22012620
MIRT535957	hsa-miR-4666a-5p	PAR-CLIP	22012620
MIRT535956	hsa-miR-5089-5p	PAR-CLIP	22012620
MIRT1155152	hsa-miR-4729	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	IEA
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	TAS
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	IBA
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006071	Process	Glycerol metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006651	Process	Diacylglycerol biosynthetic process	IBA
GO:0006651	Process	Diacylglycerol biosynthetic process	IEA
GO:0008374	Function	O-acyltransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0019432	Process	Triglyceride biosynthetic process	IBA
GO:0019432	Process	Triglyceride biosynthetic process	IEA
GO:0019432	Process	Triglyceride biosynthetic process	TAS

MIM	HGNC	e!Ensembl
610268	18210	ENSG00000124003

Q96PD6

Protein name

2-acylglycerol O-acyltransferase 1 (EC 2.3.1.22) (Acyl-CoA:monoacylglycerol acyltransferase 1) (MGAT1) (Diacylglycerol O-acyltransferase candidate 2) (hDC2) (Diacylglycerol acyltransferase 2-like protein 1) (Monoacylglycerol O-acyltransferase 1)

Protein function

Involved in glycerolipid synthesis and lipid metabolism. Catalyzes the formation of diacylglycerol, the precursor of triacylglycerol, by transferring the acyl chain of a fatty acyl-CoA to a monoacylglycerol, mainly at the sn-1 or sn-3 positions.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03982	DAGAT	40 → 335	Diacylglycerol acyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in stomach and liver. {ECO:0000269|PubMed:12621063}.

Sequence

MKVEFAPLNIQLARRLQTVAVLQWVLKYLLLGPMSIGITVMLIIHNYLFLYIPYLMWLYF
DWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFG
NFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGN
ISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPE
GSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQE
QIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK

Sequence length

335

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Metabolic pathways		Triglyceride biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
UVEAL MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (49)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	37188790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24037315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38170155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32143591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30138037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	31071333		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	16611082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31071333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	35954202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24262292	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24572742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26418287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24572742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26302655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	26302655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29812971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29812971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Galactosemias	Galactosemia	BEFREE	26733289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31494931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31494931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31494931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31494931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31494931	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	18620796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	31071333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31071333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	18455219, 29499855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21628872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29310626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24037315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22957033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30307765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27221585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28328322, 31230217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21629267, 22488447, 23351704, 24572742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23351704, 24572742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24037315, 29310626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonketotic Hyperglycinemia	Nonketotic Hyperglycinemia	BEFREE	31230217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	17582620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19851299, 21304485, 24262292, 27871764, 29853530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21304485, 26449484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	32789750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34761629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22957033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	17582620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16604304, 16611082, 18400471, 26302655, 26691576, 27789188, 29338548, 29499855, 29969029, 30080045, 31118638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29812971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31631566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38170155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MOGAT1 (monoacylglycerol O-acyltransferase 1)