Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	116211
Gene name	Transmembrane 4 L six family member 19
Gene symbol	TM4SF19
Synonyms (NCBI Gene)	OCTM4
Chromosome	3
Chromosome location	3q29
Summary	The protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain

Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT708910	hsa-miR-6776-3p	HITS-CLIP	19536157
MIRT708909	hsa-miR-200c-5p	HITS-CLIP	19536157
MIRT708908	hsa-miR-550a-3p	HITS-CLIP	19536157
MIRT708907	hsa-miR-203b-3p	HITS-CLIP	19536157
MIRT708910	hsa-miR-6776-3p	HITS-CLIP	19536157
MIRT708909	hsa-miR-200c-5p	HITS-CLIP	19536157
MIRT708908	hsa-miR-550a-3p	HITS-CLIP	19536157
MIRT708907	hsa-miR-203b-3p	HITS-CLIP	19536157
MIRT708910	hsa-miR-6776-3p	HITS-CLIP	19536157
MIRT708909	hsa-miR-200c-5p	HITS-CLIP	19536157
MIRT708908	hsa-miR-550a-3p	HITS-CLIP	19536157
MIRT708907	hsa-miR-203b-3p	HITS-CLIP	19536157
MIRT708910	hsa-miR-6776-3p	HITS-CLIP	19536157
MIRT708909	hsa-miR-200c-5p	HITS-CLIP	19536157
MIRT708908	hsa-miR-550a-3p	HITS-CLIP	19536157
MIRT708907	hsa-miR-203b-3p	HITS-CLIP	19536157
MIRT708910	hsa-miR-6776-3p	HITS-CLIP	19536157
MIRT708909	hsa-miR-200c-5p	HITS-CLIP	19536157
MIRT708908	hsa-miR-550a-3p	HITS-CLIP	19536157
MIRT708907	hsa-miR-203b-3p	HITS-CLIP	19536157
MIRT708910	hsa-miR-6776-3p	HITS-CLIP	19536157
MIRT708909	hsa-miR-200c-5p	HITS-CLIP	19536157
MIRT708908	hsa-miR-550a-3p	HITS-CLIP	19536157
MIRT708907	hsa-miR-203b-3p	HITS-CLIP	19536157
MIRT708910	hsa-miR-6776-3p	HITS-CLIP	19536157
MIRT708909	hsa-miR-200c-5p	HITS-CLIP	19536157
MIRT708908	hsa-miR-550a-3p	HITS-CLIP	19536157
MIRT708907	hsa-miR-203b-3p	HITS-CLIP	19536157
MIRT708910	hsa-miR-6776-3p	HITS-CLIP	19536157
MIRT708909	hsa-miR-200c-5p	HITS-CLIP	19536157
MIRT708908	hsa-miR-550a-3p	HITS-CLIP	19536157
MIRT708907	hsa-miR-203b-3p	HITS-CLIP	19536157
MIRT2349641	hsa-miR-3622a-3p	CLIP-seq
MIRT2349642	hsa-miR-3622b-3p	CLIP-seq
MIRT2349643	hsa-miR-490-5p	CLIP-seq
MIRT2349644	hsa-miR-619	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 38016540
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	ISS
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030175	Component	Filopodium	IEA
GO:0030175	Component	Filopodium	ISS
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IMP	38016540

MIM	HGNC	e!Ensembl
620845	25167	ENSG00000145107

Q96DZ7

Protein name

Transmembrane 4 L6 family member 19 (Osteoclast maturation-associated gene 4 protein) (Tetraspan membrane protein OCTM4)

Protein function

Negatively regulates vacuolar (H+)-ATPase (V-ATPase) activity by interacting with members of V-ATPase V0 complex and hence inhibiting V1-V0 complex assembly. Required for multinucleation during osteoclast differentiation. {ECO:0000250|UniProtKB:

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05805	L6_membrane	9 → 208	L6 membrane protein	Family

Tissue specificity

TISSUE SPECIFICITY: In adipose tissue, expressed by macrophages. {ECO:0000269|PubMed:38555350}.

Sequence

MVSSPCTQASSRTCSRILGLSLGTAALFAAGANVALLLPNWDVTYLLRGLLGRHAMLGTG
LWGGGLMVLTAAILISLMGWRYGCFSKSGLCRSVLTALLSGGLALLGALICFVTSGVALK
DGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSLFSAL
LCISLLQLLLVVVHVINSLLGLFCSLCEK

Sequence length

209

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	38315837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36411963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TM4SF19 (transmembrane 4 L six family member 19)