CMTM5 (CKLF like MARVEL transmembrane domain containing 5)

Gene

• Entrez ID: 116173
• Gene name: CKLF like MARVEL transmembrane domain containing 5
• Gene symbol: CMTM5
• Synonyms (NCBI Gene): CKLFSF5
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: This gene encodes a member of the chemokine-like factor superfamily. This family of genes encodes multi-pass membrane proteins that are similar to both the chemokine and the transmembrane 4 superfamilies of signaling molecules. The encoded protein may exh

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1966726	hsa-miR-3690	CLIP-seq
MIRT1966727	hsa-miR-4254	CLIP-seq
MIRT1966728	hsa-miR-4786-3p	CLIP-seq
MIRT1966729	hsa-miR-4793-5p	CLIP-seq
MIRT2202474	hsa-miR-149	CLIP-seq
MIRT2202475	hsa-miR-3064-5p	CLIP-seq
MIRT2202476	hsa-miR-3183	CLIP-seq
MIRT2202477	hsa-miR-326	CLIP-seq
MIRT2202478	hsa-miR-330-5p	CLIP-seq
MIRT2202479	hsa-miR-3652	CLIP-seq
MIRT2202480	hsa-miR-378g	CLIP-seq
MIRT2202481	hsa-miR-3909	CLIP-seq
MIRT2202482	hsa-miR-4430	CLIP-seq
MIRT2202483	hsa-miR-4437	CLIP-seq
MIRT2202484	hsa-miR-4505	CLIP-seq
MIRT2202485	hsa-miR-4674	CLIP-seq
MIRT2202486	hsa-miR-4723-3p	CLIP-seq
MIRT2202487	hsa-miR-4794	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 25910212, 26871637, 29892012, 30614533, 31515488, 32296183
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA

Other IDs

• MIM: 607888
• HGNC: 19176
• e!Ensembl: ENSG00000166091

Protein

• UniProt ID: Q96DZ9
• Protein name: CKLF-like MARVEL transmembrane domain-containing protein 5 (Chemokine-like factor superfamily member 5)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01284	MARVEL	29 → 155	Membrane-associating domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in the brain. {ECO:0000269|PubMed:12782130}.
• Sequence:

  MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYM
  AAALLEFFITLAFLFLYATQYYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPW
  PGLTPPGWHTPAAVPWVPAPAPGFWSWLLWFICFHSLGSSDFLRCVSAIIIFLVVSFAAV
  TSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ

• Sequence length: 223

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	32568178, 33478201	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21841490	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36975415	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21841490	Inhibit	★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19124004		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28789377		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28457985		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28457985		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28457985		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21168207		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29213215, 29691981, 29990439		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33478201	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19577543		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28789377		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	21168207		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17908965, 19124004, 19577543, 21168207, 24721428, 28789377, 29213215		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21841490	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19577543		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34791506	Inhibit	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28789377		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24721428		★☆☆☆☆ Found in Text Mining only