Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	116154
Gene name	Phosphatase and actin regulator 3
Gene symbol	PHACTR3
Synonyms (NCBI Gene)	C20orf101H17739PPP1R123SCAPIN1SCAPININ
Chromosome	20
Chromosome location	20q13.32-q13.33
Summary	This gene encodes a member of the phosphatase and actin regulator protein family. The encoded protein is associated with the nuclear scaffold in proliferating cells, and binds to actin and the catalytic subunit of protein phosphatase-1, suggesting that it

Show/Hide all (51)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052804	hsa-miR-3181	CLASH	23622248
MIRT1228974	hsa-miR-200b	CLIP-seq
MIRT1228975	hsa-miR-200c	CLIP-seq
MIRT1228976	hsa-miR-3117-5p	CLIP-seq
MIRT1228977	hsa-miR-425	CLIP-seq
MIRT1228978	hsa-miR-429	CLIP-seq
MIRT1228979	hsa-miR-4717-3p	CLIP-seq
MIRT1228980	hsa-miR-4724-5p	CLIP-seq
MIRT2592435	hsa-miR-1247	CLIP-seq
MIRT2592436	hsa-miR-1252	CLIP-seq
MIRT2592437	hsa-miR-1324	CLIP-seq
MIRT2592438	hsa-miR-136	CLIP-seq
MIRT2592439	hsa-miR-298	CLIP-seq
MIRT1228976	hsa-miR-3117-5p	CLIP-seq
MIRT2592440	hsa-miR-3158-5p	CLIP-seq
MIRT2592441	hsa-miR-3192	CLIP-seq
MIRT2592442	hsa-miR-3607-3p	CLIP-seq
MIRT2592443	hsa-miR-377	CLIP-seq
MIRT2592444	hsa-miR-4257	CLIP-seq
MIRT2592445	hsa-miR-4418	CLIP-seq
MIRT2592446	hsa-miR-4476	CLIP-seq
MIRT2592447	hsa-miR-4533	CLIP-seq
MIRT2592448	hsa-miR-4691-5p	CLIP-seq
MIRT2592449	hsa-miR-4709-5p	CLIP-seq
MIRT2592450	hsa-miR-4710	CLIP-seq
MIRT1228979	hsa-miR-4717-3p	CLIP-seq
MIRT2592451	hsa-miR-4792	CLIP-seq
MIRT2592452	hsa-miR-483-3p	CLIP-seq
MIRT2592453	hsa-miR-488	CLIP-seq
MIRT2592454	hsa-miR-509-3-5p	CLIP-seq
MIRT2592455	hsa-miR-509-5p	CLIP-seq
MIRT2592456	hsa-miR-548an	CLIP-seq
MIRT2592457	hsa-miR-595	CLIP-seq
MIRT2592458	hsa-miR-596	CLIP-seq
MIRT2592459	hsa-miR-624	CLIP-seq
MIRT2592460	hsa-miR-661	CLIP-seq
MIRT2592461	hsa-miR-885-5p	CLIP-seq
MIRT2592436	hsa-miR-1252	CLIP-seq
MIRT2592437	hsa-miR-1324	CLIP-seq
MIRT1228976	hsa-miR-3117-5p	CLIP-seq
MIRT2687798	hsa-miR-3657	CLIP-seq
MIRT2592443	hsa-miR-377	CLIP-seq
MIRT2687799	hsa-miR-3909	CLIP-seq
MIRT2687800	hsa-miR-409-5p	CLIP-seq
MIRT2592446	hsa-miR-4476	CLIP-seq
MIRT2592447	hsa-miR-4533	CLIP-seq
MIRT2687801	hsa-miR-4669	CLIP-seq
MIRT2592449	hsa-miR-4709-5p	CLIP-seq
MIRT1228979	hsa-miR-4717-3p	CLIP-seq
MIRT2592452	hsa-miR-483-3p	CLIP-seq
MIRT2592457	hsa-miR-595	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IBA
GO:0003779	Function	Actin binding	IEA
GO:0004864	Function	Protein phosphatase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0016363	Component	Nuclear matrix	IEA
GO:0030036	Process	Actin cytoskeleton organization	IBA

MIM	HGNC	e!Ensembl
608725	15833	ENSG00000087495

Q96KR7

Protein name

Phosphatase and actin regulator 3 (Scaffold-associated PP1-inhibiting protein) (Scapinin)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02755	RPEL	440 → 463	RPEL repeat	Disordered

Tissue specificity

TISSUE SPECIFICITY: Abundantly expressed in brain. Also found in several tumors such as lung carcinomas, nervous tumors and HL-60 leukemia cells. Isoform 3 is the major form in U-937, GOTO and HL-60 leukemia cells.

Sequence

MAASEDGSGCLVSRGRSQSDPSVLTDSSATSSADAGENPDEMDQTPPARPEYLVSGIRTP
PVRRNSKLATLGRIFKPWKWRKKKNEKLKQTTSALEKKMAGRQGREELIKKGLLEMMEQD
AESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDDA
AKMPSASSGEEADAGSLLPTTNELSQALAGADSLDSPPRPLERSVGQLPSPPLLPTPPPK
ASSKTTKNVTGQATLFQASSMKSADPSLRGQLSTPTGSPHLTTVHRPLPPSRVIEELHRA
LATKHRQDSFQGRESKGSPKKRLDVRLSRTSSVERGKEREEAWSFDGALENKRTAAKESE
ENKENLIINSELKDDLLLYQDEEALNDSIISGTLPRKCKKELLAVKLRNRPSKQELEDRN
IFPRRTDEERQEIRQQIEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLT
RKLNQRPTVDELRDRKILIRFSDYVEVAKAQDYDRRADKPWTRLSAADKAAIRKELNEYK
SNEMEVHASSKHLTRFHRP

Sequence length

559

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22135045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37473877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 22491018		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	22491018, 30891314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	28991256		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35123558	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PHACTR3 (phosphatase and actin regulator 3)