Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	116071
Gene name	Basic leucine zipper ATF-like transcription factor 2
Gene symbol	BATF2
Synonyms (NCBI Gene)	SARI
Chromosome	11
Chromosome location	11q13.1

215

Show/Hide all (215)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017734	hsa-miR-335-5p	Microarray	18185580
MIRT019820	hsa-miR-375	Microarray	20215506
MIRT023328	hsa-miR-122-5p	Microarray	17612493
MIRT736956	hsa-miR-765	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	32166887
MIRT755973	hsa-miR-5189-3p	Luciferase reporter assayWestern blottingqRT-PCR	35246006
MIRT816062	hsa-miR-122	CLIP-seq
MIRT816063	hsa-miR-1231	CLIP-seq
MIRT816064	hsa-miR-1288	CLIP-seq
MIRT816065	hsa-miR-1827	CLIP-seq
MIRT816066	hsa-miR-217	CLIP-seq
MIRT816067	hsa-miR-2909	CLIP-seq
MIRT816068	hsa-miR-3119	CLIP-seq
MIRT816069	hsa-miR-3150a-3p	CLIP-seq
MIRT816070	hsa-miR-3170	CLIP-seq
MIRT816071	hsa-miR-3175	CLIP-seq
MIRT816072	hsa-miR-3192	CLIP-seq
MIRT816073	hsa-miR-3199	CLIP-seq
MIRT816074	hsa-miR-34a	CLIP-seq
MIRT816075	hsa-miR-34c-5p	CLIP-seq
MIRT816076	hsa-miR-3612	CLIP-seq
MIRT816077	hsa-miR-4255	CLIP-seq
MIRT816078	hsa-miR-4278	CLIP-seq
MIRT816079	hsa-miR-4288	CLIP-seq
MIRT816080	hsa-miR-4314	CLIP-seq
MIRT816081	hsa-miR-449a	CLIP-seq
MIRT816082	hsa-miR-449b	CLIP-seq
MIRT816083	hsa-miR-4637	CLIP-seq
MIRT816084	hsa-miR-4646-5p	CLIP-seq
MIRT816085	hsa-miR-4688	CLIP-seq
MIRT816086	hsa-miR-4729	CLIP-seq
MIRT816087	hsa-miR-4765	CLIP-seq
MIRT816088	hsa-miR-4766-5p	CLIP-seq
MIRT816089	hsa-miR-4796-3p	CLIP-seq
MIRT816090	hsa-miR-4803	CLIP-seq
MIRT816091	hsa-miR-486-3p	CLIP-seq
MIRT816092	hsa-miR-491-5p	CLIP-seq
MIRT816093	hsa-miR-548t	CLIP-seq
MIRT816094	hsa-miR-579	CLIP-seq
MIRT816095	hsa-miR-632	CLIP-seq
MIRT816096	hsa-miR-650	CLIP-seq
MIRT816097	hsa-miR-939	CLIP-seq
MIRT1941391	hsa-miR-1236	CLIP-seq
MIRT1941392	hsa-miR-1238	CLIP-seq
MIRT1941393	hsa-miR-3124-3p	CLIP-seq
MIRT1941394	hsa-miR-759	CLIP-seq
MIRT2180137	hsa-miR-1233	CLIP-seq
MIRT2180138	hsa-miR-1254	CLIP-seq
MIRT2180139	hsa-miR-128	CLIP-seq
MIRT2180140	hsa-miR-27a	CLIP-seq
MIRT2180141	hsa-miR-27b	CLIP-seq
MIRT2180142	hsa-miR-3116	CLIP-seq
MIRT2180143	hsa-miR-3180-5p	CLIP-seq
MIRT2180144	hsa-miR-3200-3p	CLIP-seq
MIRT2180145	hsa-miR-3667-3p	CLIP-seq
MIRT2180146	hsa-miR-4267	CLIP-seq
MIRT2180147	hsa-miR-4434	CLIP-seq
MIRT2180148	hsa-miR-4436a	CLIP-seq
MIRT2180149	hsa-miR-4516	CLIP-seq
MIRT2180150	hsa-miR-4640-5p	CLIP-seq
MIRT2180151	hsa-miR-4726-5p	CLIP-seq
MIRT2180152	hsa-miR-4768-3p	CLIP-seq
MIRT2180153	hsa-miR-508-5p	CLIP-seq
MIRT2180154	hsa-miR-661	CLIP-seq
MIRT2180155	hsa-miR-766	CLIP-seq
MIRT2180144	hsa-miR-3200-3p	CLIP-seq
MIRT2180145	hsa-miR-3667-3p	CLIP-seq
MIRT816077	hsa-miR-4255	CLIP-seq
MIRT816083	hsa-miR-4637	CLIP-seq
MIRT816090	hsa-miR-4803	CLIP-seq
MIRT816077	hsa-miR-4255	CLIP-seq
MIRT816083	hsa-miR-4637	CLIP-seq
MIRT816090	hsa-miR-4803	CLIP-seq
MIRT2483524	hsa-miR-1207-3p	CLIP-seq
MIRT2483525	hsa-miR-1225-5p	CLIP-seq
MIRT2483526	hsa-miR-1226	CLIP-seq
MIRT2483527	hsa-miR-1228	CLIP-seq
MIRT1941391	hsa-miR-1236	CLIP-seq
MIRT2180138	hsa-miR-1254	CLIP-seq
MIRT2483528	hsa-miR-1265	CLIP-seq
MIRT2180139	hsa-miR-128	CLIP-seq
MIRT2483529	hsa-miR-1293	CLIP-seq
MIRT2483530	hsa-miR-1321	CLIP-seq
MIRT2483531	hsa-miR-1343	CLIP-seq
MIRT2483532	hsa-miR-150	CLIP-seq
MIRT2483533	hsa-miR-1912	CLIP-seq
MIRT2483534	hsa-miR-199a-3p	CLIP-seq
MIRT2483535	hsa-miR-199b-3p	CLIP-seq
MIRT2483536	hsa-miR-2392	CLIP-seq
MIRT2483537	hsa-miR-2467-3p	CLIP-seq
MIRT2180140	hsa-miR-27a	CLIP-seq
MIRT2180141	hsa-miR-27b	CLIP-seq
MIRT2483538	hsa-miR-298	CLIP-seq
MIRT2483539	hsa-miR-3065-3p	CLIP-seq
MIRT2483540	hsa-miR-3115	CLIP-seq
MIRT2180142	hsa-miR-3116	CLIP-seq
MIRT2483541	hsa-miR-3126-5p	CLIP-seq
MIRT2483542	hsa-miR-3129-5p	CLIP-seq
MIRT2483543	hsa-miR-3130-5p	CLIP-seq
MIRT2483544	hsa-miR-3150b-3p	CLIP-seq
MIRT2483545	hsa-miR-3157-5p	CLIP-seq
MIRT2483546	hsa-miR-3158-5p	CLIP-seq
MIRT2483547	hsa-miR-3167	CLIP-seq
MIRT2483548	hsa-miR-3173-3p	CLIP-seq
MIRT2483549	hsa-miR-3174	CLIP-seq
MIRT2180143	hsa-miR-3180-5p	CLIP-seq
MIRT816076	hsa-miR-3612	CLIP-seq
MIRT2483550	hsa-miR-3650	CLIP-seq
MIRT2483551	hsa-miR-3689a-3p	CLIP-seq
MIRT2483552	hsa-miR-3689c	CLIP-seq
MIRT2483553	hsa-miR-3909	CLIP-seq
MIRT2483554	hsa-miR-4419a	CLIP-seq
MIRT2180147	hsa-miR-4434	CLIP-seq
MIRT2180148	hsa-miR-4436a	CLIP-seq
MIRT2483555	hsa-miR-4436b-3p	CLIP-seq
MIRT2483556	hsa-miR-4468	CLIP-seq
MIRT2483557	hsa-miR-4474-3p	CLIP-seq
MIRT2483558	hsa-miR-4482	CLIP-seq
MIRT2483559	hsa-miR-4483	CLIP-seq
MIRT2483560	hsa-miR-4510	CLIP-seq
MIRT2180149	hsa-miR-4516	CLIP-seq
MIRT2180150	hsa-miR-4640-5p	CLIP-seq
MIRT2483561	hsa-miR-4690-3p	CLIP-seq
MIRT2483562	hsa-miR-4691-3p	CLIP-seq
MIRT2483563	hsa-miR-4711-5p	CLIP-seq
MIRT2483564	hsa-miR-4713-5p	CLIP-seq
MIRT2483565	hsa-miR-4725-5p	CLIP-seq
MIRT2180151	hsa-miR-4726-5p	CLIP-seq
MIRT2483566	hsa-miR-4728-5p	CLIP-seq
MIRT2483567	hsa-miR-4739	CLIP-seq
MIRT2483568	hsa-miR-4756-5p	CLIP-seq
MIRT2180152	hsa-miR-4768-3p	CLIP-seq
MIRT2483569	hsa-miR-4784	CLIP-seq
MIRT2483570	hsa-miR-504	CLIP-seq
MIRT2483571	hsa-miR-516a-3p	CLIP-seq
MIRT2483572	hsa-miR-532-3p	CLIP-seq
MIRT2483573	hsa-miR-605	CLIP-seq
MIRT2483574	hsa-miR-644	CLIP-seq
MIRT816096	hsa-miR-650	CLIP-seq
MIRT2180154	hsa-miR-661	CLIP-seq
MIRT2483575	hsa-miR-665	CLIP-seq
MIRT2483576	hsa-miR-876-5p	CLIP-seq
MIRT2483577	hsa-miR-921	CLIP-seq
MIRT2483524	hsa-miR-1207-3p	CLIP-seq
MIRT2483525	hsa-miR-1225-5p	CLIP-seq
MIRT2483526	hsa-miR-1226	CLIP-seq
MIRT2483527	hsa-miR-1228	CLIP-seq
MIRT2180138	hsa-miR-1254	CLIP-seq
MIRT2483528	hsa-miR-1265	CLIP-seq
MIRT2180139	hsa-miR-128	CLIP-seq
MIRT2483529	hsa-miR-1293	CLIP-seq
MIRT2483530	hsa-miR-1321	CLIP-seq
MIRT2483531	hsa-miR-1343	CLIP-seq
MIRT2483532	hsa-miR-150	CLIP-seq
MIRT2483533	hsa-miR-1912	CLIP-seq
MIRT2483534	hsa-miR-199a-3p	CLIP-seq
MIRT2483535	hsa-miR-199b-3p	CLIP-seq
MIRT2483536	hsa-miR-2392	CLIP-seq
MIRT2483537	hsa-miR-2467-3p	CLIP-seq
MIRT2180140	hsa-miR-27a	CLIP-seq
MIRT2180141	hsa-miR-27b	CLIP-seq
MIRT2483538	hsa-miR-298	CLIP-seq
MIRT2483539	hsa-miR-3065-3p	CLIP-seq
MIRT2483540	hsa-miR-3115	CLIP-seq
MIRT2180142	hsa-miR-3116	CLIP-seq
MIRT2483541	hsa-miR-3126-5p	CLIP-seq
MIRT2483542	hsa-miR-3129-5p	CLIP-seq
MIRT2483543	hsa-miR-3130-5p	CLIP-seq
MIRT2483544	hsa-miR-3150b-3p	CLIP-seq
MIRT2483545	hsa-miR-3157-5p	CLIP-seq
MIRT2483546	hsa-miR-3158-5p	CLIP-seq
MIRT2483547	hsa-miR-3167	CLIP-seq
MIRT2483548	hsa-miR-3173-3p	CLIP-seq
MIRT2483549	hsa-miR-3174	CLIP-seq
MIRT2180143	hsa-miR-3180-5p	CLIP-seq
MIRT2675872	hsa-miR-3181	CLIP-seq
MIRT816076	hsa-miR-3612	CLIP-seq
MIRT2483550	hsa-miR-3650	CLIP-seq
MIRT2483551	hsa-miR-3689a-3p	CLIP-seq
MIRT2483552	hsa-miR-3689c	CLIP-seq
MIRT2675873	hsa-miR-3944-3p	CLIP-seq
MIRT2483554	hsa-miR-4419a	CLIP-seq
MIRT2180147	hsa-miR-4434	CLIP-seq
MIRT2180148	hsa-miR-4436a	CLIP-seq
MIRT2483555	hsa-miR-4436b-3p	CLIP-seq
MIRT2483556	hsa-miR-4468	CLIP-seq
MIRT2483557	hsa-miR-4474-3p	CLIP-seq
MIRT2483558	hsa-miR-4482	CLIP-seq
MIRT2483559	hsa-miR-4483	CLIP-seq
MIRT2483560	hsa-miR-4510	CLIP-seq
MIRT2180149	hsa-miR-4516	CLIP-seq
MIRT2180150	hsa-miR-4640-5p	CLIP-seq
MIRT2483561	hsa-miR-4690-3p	CLIP-seq
MIRT2483562	hsa-miR-4691-3p	CLIP-seq
MIRT2675874	hsa-miR-4694-5p	CLIP-seq
MIRT2483563	hsa-miR-4711-5p	CLIP-seq
MIRT2483564	hsa-miR-4713-5p	CLIP-seq
MIRT2483565	hsa-miR-4725-5p	CLIP-seq
MIRT2180151	hsa-miR-4726-5p	CLIP-seq
MIRT2483566	hsa-miR-4728-5p	CLIP-seq
MIRT2483567	hsa-miR-4739	CLIP-seq
MIRT2675875	hsa-miR-4747-3p	CLIP-seq
MIRT2675876	hsa-miR-4750	CLIP-seq
MIRT2483568	hsa-miR-4756-5p	CLIP-seq
MIRT2180152	hsa-miR-4768-3p	CLIP-seq
MIRT2483569	hsa-miR-4784	CLIP-seq
MIRT2483570	hsa-miR-504	CLIP-seq
MIRT2483571	hsa-miR-516a-3p	CLIP-seq
MIRT2483572	hsa-miR-532-3p	CLIP-seq
MIRT2483573	hsa-miR-605	CLIP-seq
MIRT2483574	hsa-miR-644	CLIP-seq
MIRT816096	hsa-miR-650	CLIP-seq
MIRT2180154	hsa-miR-661	CLIP-seq
MIRT2483575	hsa-miR-665	CLIP-seq
MIRT2483576	hsa-miR-876-5p	CLIP-seq
MIRT2483577	hsa-miR-921	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 19074269, 21988832, 23661758, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	23661758
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	23661758
GO:0030154	Process	Cell differentiation	IEA
GO:0042832	Process	Defense response to protozoan	IEA
GO:0042832	Process	Defense response to protozoan	ISS
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043011	Process	Myeloid dendritic cell differentiation	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	23661758
GO:0140467	Process	Integrated stress response signaling	NAS	28566324

MIM	HGNC	e!Ensembl
614983	25163	ENSG00000168062

Q8N1L9

Protein name

Basic leucine zipper transcriptional factor ATF-like 2 (B-ATF-2) (Suppressor of AP-1 regulated by IFN) (SARI)

Protein function

AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system. Following infection, participates in the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	15 → 72	bZIP transcription factor	Coiled-coil

Sequence

MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALR
KEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQ
LELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASH
TGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREH
KPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF

Sequence length

274

Interactions

View interactions

	KEGG
	PD-L1 expression and PD-1 checkpoint pathway in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPERURICEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (40)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23049725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30732531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30732531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36077244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34565331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24133583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	27785591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30753547, 31182817, 31578820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27353863, 30771439, 31182817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31174572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30732531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	36672163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28739720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28739720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	36672163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	30753547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	36672163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20473897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24133583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24133583	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24133583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26339361, 31276688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31549215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23049725, 24282278, 26135942, 26376615, 28739720, 29534174, 31578820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27353863, 30771439, 31182817		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	22535842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	24282278		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	30732531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	30732531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20473897, 24133583, 26135942, 26376615, 27353863, 28739720, 31276688, 31578820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24133583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pharyngitis	Pharyngitis	BEFREE	22804843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26339361, 31276688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26339361	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	27207342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	27207342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26135942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35949109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31549215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32166887, 37781029, 40320925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BATF2 (basic leucine zipper ATF-like transcription factor 2)