Gene Gene information from NCBI Gene database.
Entrez ID 116
Gene name Adenylate cyclase activating polypeptide 1
Gene symbol ADCYAP1
Synonyms (NCBI Gene)
PACAP
Chromosome 18
Chromosome location 18p11.32
Summary This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target ge
miRNA miRNA information provided by mirtarbase database.
215
miRTarBase ID miRNA Experiments Reference
MIRT712596 hsa-miR-8066 HITS-CLIP 19536157
MIRT712595 hsa-miR-221-5p HITS-CLIP 19536157
MIRT712594 hsa-miR-8073 HITS-CLIP 19536157
MIRT712593 hsa-miR-3653-5p HITS-CLIP 19536157
MIRT712592 hsa-miR-1976 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
53
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IPI
GO:0005179 Function Hormone activity IEA
GO:0005184 Function Neuropeptide hormone activity IBA
GO:0005184 Function Neuropeptide hormone activity IDA 23800469, 35477937, 36385145
GO:0005184 Function Neuropeptide hormone activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
102980 241 ENSG00000141433
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P18509
Protein name Pituitary adenylate cyclase-activating polypeptide (PACAP) [Cleaved into: PACAP-related peptide (PRP-48); Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27) (PACAP27); Pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38) (PACAP38
Protein function PACAP is a neuropeptide involved in diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors: VIP receptor 1 (VIPR1), VIP receptor 2 (VIPR2), and PACAP type I receptor (ADCYAP1R1) (P
PDB 1GEA , 2D2P , 2JOD , 6LPB , 6M1I , 6P9Y , 6VN7 , 7VQX , 7WBJ , 8E3X , 8E3Y
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00123 Hormone_2 83 110 Peptide hormone Family
PF00123 Hormone_2 132 159 Peptide hormone Family
Sequence
MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPG
AGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGG
AGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
Sequence length 176
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Insulin secretion
Renin secretion
  G alpha (s) signalling events
Glucagon-type ligand receptors
ADORA2B mediated anti-inflammatory cytokines production
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
15
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BIPOLAR DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CEREBRAL ARTERY OCCLUSION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 31788045
★☆☆☆☆
Found in Text Mining only
Adrenal Gland Pheochromocytoma Adrenal Gland Pheochromocytoma BEFREE 12573802, 18048093, 20483910
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 24719484, 37226771 Associate
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 23466699, 28926110, 30238989
★☆☆☆☆
Found in Text Mining only
Anxiety Anxiety Disorder BEFREE 23328528, 28450265, 29905528
★☆☆☆☆
Found in Text Mining only
Anxiety Anxiety disorder Pubtator 29249830, 31910434 Associate
★☆☆☆☆
Found in Text Mining only
Anxiety Disorders Anxiety Disorder BEFREE 23328528, 24234873, 28450265, 29905528
★☆☆☆☆
Found in Text Mining only
Anxiety Disorders Anxiety disorder Pubtator 31910434 Associate
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 30447883
★☆☆☆☆
Found in Text Mining only
Arthropathy Arthropathy BEFREE 30621194
★☆☆☆☆
Found in Text Mining only