Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	116
Gene name	Adenylate cyclase activating polypeptide 1
Gene symbol	ADCYAP1
Synonyms (NCBI Gene)	PACAP
Chromosome	18
Chromosome location	18p11.32
Summary	This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target ge

215

Show/Hide all (215)

miRTarBase ID	miRNA	Experiments	Reference
MIRT712596	hsa-miR-8066	HITS-CLIP	19536157
MIRT712595	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT712594	hsa-miR-8073	HITS-CLIP	19536157
MIRT712593	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712592	hsa-miR-1976	HITS-CLIP	19536157
MIRT712591	hsa-miR-6868-5p	HITS-CLIP	19536157
MIRT712590	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT712589	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT712588	hsa-miR-7641	HITS-CLIP	19536157
MIRT712587	hsa-miR-106a-3p	HITS-CLIP	19536157
MIRT712586	hsa-miR-450b-5p	HITS-CLIP	19536157
MIRT712596	hsa-miR-8066	HITS-CLIP	19536157
MIRT712595	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT712594	hsa-miR-8073	HITS-CLIP	19536157
MIRT712593	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712592	hsa-miR-1976	HITS-CLIP	19536157
MIRT712591	hsa-miR-6868-5p	HITS-CLIP	19536157
MIRT712590	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT712589	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT712588	hsa-miR-7641	HITS-CLIP	19536157
MIRT712587	hsa-miR-106a-3p	HITS-CLIP	19536157
MIRT712586	hsa-miR-450b-5p	HITS-CLIP	19536157
MIRT712596	hsa-miR-8066	HITS-CLIP	19536157
MIRT712595	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT712594	hsa-miR-8073	HITS-CLIP	19536157
MIRT712593	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712592	hsa-miR-1976	HITS-CLIP	19536157
MIRT712591	hsa-miR-6868-5p	HITS-CLIP	19536157
MIRT712590	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT712589	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT712588	hsa-miR-7641	HITS-CLIP	19536157
MIRT712587	hsa-miR-106a-3p	HITS-CLIP	19536157
MIRT712586	hsa-miR-450b-5p	HITS-CLIP	19536157
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508279	hsa-miR-6074	HITS-CLIP	21572407
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT508278	hsa-miR-6083	HITS-CLIP	21572407
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508279	hsa-miR-6074	HITS-CLIP	23313552
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508279	hsa-miR-6074	HITS-CLIP	23313552
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT639088	hsa-miR-4803	HITS-CLIP	23824327
MIRT639087	hsa-miR-1323	HITS-CLIP	23824327
MIRT639086	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT639085	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT639084	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT639083	hsa-miR-607	HITS-CLIP	23824327
MIRT639082	hsa-miR-1305	HITS-CLIP	23824327
MIRT639081	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT549625	hsa-miR-1284	PAR-CLIP	20371350
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508278	hsa-miR-6083	PAR-CLIP	20371350
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508279	hsa-miR-6074	PAR-CLIP	21572407
MIRT549625	hsa-miR-1284	PAR-CLIP	21572407
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508278	hsa-miR-6083	PAR-CLIP	21572407
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508279	hsa-miR-6074	PAR-CLIP	23446348
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508278	hsa-miR-6083	PAR-CLIP	23446348
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT712596	hsa-miR-8066	HITS-CLIP	19536157
MIRT712595	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT712594	hsa-miR-8073	HITS-CLIP	19536157
MIRT712593	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712592	hsa-miR-1976	HITS-CLIP	19536157
MIRT712591	hsa-miR-6868-5p	HITS-CLIP	19536157
MIRT712590	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT712589	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT712588	hsa-miR-7641	HITS-CLIP	19536157
MIRT712587	hsa-miR-106a-3p	HITS-CLIP	19536157
MIRT712586	hsa-miR-450b-5p	HITS-CLIP	19536157
MIRT712596	hsa-miR-8066	HITS-CLIP	19536157
MIRT712595	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT712594	hsa-miR-8073	HITS-CLIP	19536157
MIRT712593	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712592	hsa-miR-1976	HITS-CLIP	19536157
MIRT712591	hsa-miR-6868-5p	HITS-CLIP	19536157
MIRT712590	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT712589	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT712588	hsa-miR-7641	HITS-CLIP	19536157
MIRT712587	hsa-miR-106a-3p	HITS-CLIP	19536157
MIRT712586	hsa-miR-450b-5p	HITS-CLIP	19536157
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508279	hsa-miR-6074	HITS-CLIP	21572407
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT508278	hsa-miR-6083	HITS-CLIP	21572407
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508279	hsa-miR-6074	HITS-CLIP	23313552
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508279	hsa-miR-6074	HITS-CLIP	23313552
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT639088	hsa-miR-4803	HITS-CLIP	23824327
MIRT639087	hsa-miR-1323	HITS-CLIP	23824327
MIRT639086	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT639085	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT639084	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT639083	hsa-miR-607	HITS-CLIP	23824327
MIRT639082	hsa-miR-1305	HITS-CLIP	23824327
MIRT639081	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT549625	hsa-miR-1284	PAR-CLIP	20371350
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508278	hsa-miR-6083	PAR-CLIP	20371350
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508279	hsa-miR-6074	PAR-CLIP	21572407
MIRT549625	hsa-miR-1284	PAR-CLIP	21572407
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508278	hsa-miR-6083	PAR-CLIP	21572407
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508279	hsa-miR-6074	PAR-CLIP	23446348
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508278	hsa-miR-6083	PAR-CLIP	23446348
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT768341	hsa-miR-132	CLIP-seq
MIRT768342	hsa-miR-212	CLIP-seq
MIRT768343	hsa-miR-329	CLIP-seq
MIRT768344	hsa-miR-362-3p	CLIP-seq
MIRT768345	hsa-miR-3941	CLIP-seq
MIRT768346	hsa-miR-3973	CLIP-seq
MIRT768347	hsa-miR-410	CLIP-seq
MIRT768348	hsa-miR-4659a-3p	CLIP-seq
MIRT768349	hsa-miR-4659b-3p	CLIP-seq
MIRT768350	hsa-miR-466	CLIP-seq
MIRT768351	hsa-miR-4672	CLIP-seq
MIRT768352	hsa-miR-520g	CLIP-seq
MIRT768353	hsa-miR-520h	CLIP-seq
MIRT768354	hsa-miR-603	CLIP-seq
MIRT768355	hsa-miR-1249	CLIP-seq
MIRT768356	hsa-miR-1302	CLIP-seq
MIRT768357	hsa-miR-3122	CLIP-seq
MIRT768358	hsa-miR-3199	CLIP-seq
MIRT768359	hsa-miR-3619-3p	CLIP-seq
MIRT768360	hsa-miR-3686	CLIP-seq
MIRT768361	hsa-miR-3913-5p	CLIP-seq
MIRT768362	hsa-miR-4298	CLIP-seq
MIRT768363	hsa-miR-4326	CLIP-seq
MIRT768364	hsa-miR-4436a	CLIP-seq
MIRT768365	hsa-miR-4632	CLIP-seq
MIRT768366	hsa-miR-4652-3p	CLIP-seq
MIRT768367	hsa-miR-582-5p	CLIP-seq
MIRT1926651	hsa-miR-1261	CLIP-seq
MIRT768346	hsa-miR-3973	CLIP-seq
MIRT2167600	hsa-miR-1182	CLIP-seq
MIRT768355	hsa-miR-1249	CLIP-seq
MIRT2167601	hsa-miR-1266	CLIP-seq
MIRT2167602	hsa-miR-1267	CLIP-seq
MIRT2167603	hsa-miR-1912	CLIP-seq
MIRT2167604	hsa-miR-3130-5p	CLIP-seq
MIRT2167605	hsa-miR-323b-3p	CLIP-seq
MIRT2167606	hsa-miR-324-5p	CLIP-seq
MIRT2167607	hsa-miR-3664-3p	CLIP-seq
MIRT768360	hsa-miR-3686	CLIP-seq
MIRT768363	hsa-miR-4326	CLIP-seq
MIRT2167608	hsa-miR-4482	CLIP-seq
MIRT2167609	hsa-miR-4518	CLIP-seq
MIRT768366	hsa-miR-4652-3p	CLIP-seq
MIRT2167610	hsa-miR-4738-5p	CLIP-seq
MIRT768367	hsa-miR-582-5p	CLIP-seq
MIRT2426021	hsa-miR-1283	CLIP-seq

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IPI
GO:0005179	Function	Hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IDA	23800469, 35477937, 36385145
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	TAS	2302217
GO:0005515	Function	Protein binding	IPI	17470806, 25451228, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	36385145
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IMP	23800469
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384, 35477937, 36385145
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	9603988, 35477937, 36385145
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IMP	35477937
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	1730060
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	23800469
GO:0007267	Process	Cell-cell signaling	TAS	2302217
GO:0007399	Process	Nervous system development	IEA
GO:0007565	Process	Female pregnancy	TAS	10698193
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IDA	11175907
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016521	Function	Pituitary adenylate cyclase activating polypeptide activity	IBA
GO:0016521	Function	Pituitary adenylate cyclase activating polypeptide activity	IDA	9603988, 35477937, 36385145
GO:0016521	Function	Pituitary adenylate cyclase activating polypeptide activity	IEA
GO:0030073	Process	Insulin secretion	IEA
GO:0030073	Process	Insulin secretion	ISS
GO:0031175	Process	Neuron projection development	IBA
GO:0031175	Process	Neuron projection development	IDA	23800469
GO:0031891	Function	Type 1 vasoactive intestinal polypeptide receptor binding	IDA	36385145
GO:0031892	Function	Type 2 vasoactive intestinal polypeptide receptor binding	IDA	35477937
GO:0031892	Function	Type 2 vasoactive intestinal polypeptide receptor binding	IMP	35477937
GO:0032880	Process	Regulation of protein localization	IBA
GO:0032880	Process	Regulation of protein localization	IDA	9603988
GO:0032880	Process	Regulation of protein localization	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043204	Component	Perikaryon	IBA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	23800469
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	23800469
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	23800469
GO:0051428	Function	Peptide hormone receptor binding	IBA
GO:0051428	Function	Peptide hormone receptor binding	IDA	11175907
GO:0051428	Function	Peptide hormone receptor binding	IPI	17470806
GO:0060124	Process	Positive regulation of growth hormone secretion	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	23800469
GO:0071651	Process	Positive regulation of chemokine (C-C motif) ligand 5 production	IDA	24696163
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	12239106
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IBA

MIM	HGNC	e!Ensembl
102980	241	ENSG00000141433

P18509

Protein name

Pituitary adenylate cyclase-activating polypeptide (PACAP) [Cleaved into: PACAP-related peptide (PRP-48); Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27) (PACAP27); Pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38) (PACAP38

Protein function

PACAP is a neuropeptide involved in diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors: VIP receptor 1 (VIPR1), VIP receptor 2 (VIPR2), and PACAP type I receptor (ADCYAP1R1) (P

PDB

1GEA , 2D2P , 2JOD , 6LPB , 6M1I , 6P9Y , 6VN7 , 7VQX , 7WBJ , 8E3X , 8E3Y

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00123	Hormone_2	83 → 110	Peptide hormone	Family
PF00123	Hormone_2	132 → 159	Peptide hormone	Family

Sequence

MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPG
AGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGG
AGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL

Sequence length

176

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Circadian entrainment Insulin secretion Renin secretion		G alpha (s) signalling events Glucagon-type ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL ARTERY OCCLUSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOMOTOR AGITATION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER, OVERACTIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (166)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	31788045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	12573802, 18048093, 20483910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24719484, 37226771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23466699, 28926110, 30238989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23328528, 28450265, 29905528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	29249830, 31910434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23328528, 24234873, 28450265, 29905528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	31910434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30447883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	30621194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30447883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	16372333, 16888207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11515750, 18349695, 19958095		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11515750, 18349695, 19958095, 20072116		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	37226771	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Platelet Disorders	Platelet disorder	Pubtator	25758343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	18349695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10867818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	29935235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16019382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	18349695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	28511915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	21109983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11193832, 12409225, 12732341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32628820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32218699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	31788045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	20378996		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	20378996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	29353438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18483879, 30513524		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21109983, 26552048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21109983, 26552048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	16552823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	16552823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	29673861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27816700, 29526016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14742913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12409223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35880088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	26994298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	14560155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	29673861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hydrocephalus	Congenital Hydrocephalus	BEFREE	16823482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29353438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30477895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	30259317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29373492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	24719484	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	19914336, 20144662, 22178610, 25014004		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	28450265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	37226771	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	37226771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	29713744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17548123, 29466879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31485258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17548123, 29466879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28761062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11968092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31247223, 31649495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	29931503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24623538, 31902687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28323007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	29673861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esotropia	Esotropia	Pubtator	21738391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15054836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	31827422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	29673861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	23621806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30993644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29182611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29182611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10867818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29353438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29526016, 30417775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	CTD_human_DG	8637627		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	29466879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15054836, 19581838, 29212793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	19581838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28659785, 29526016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30967875		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	20007581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	27900577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	31827422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	30259317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	29353438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30513524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	29673861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30443839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	16888145, 20514524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	20034524		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28720396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	8384124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	25636177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	23897225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11193832, 22581436, 30273693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12409225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19914336, 25595671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11193832, 12409225, 12732341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11728828, 12839880, 16372333, 16888207, 9566707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12431839, 27566169, 29615974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21109983, 26552048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14742913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	19914336, 20144662, 22178610, 25014004		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	28450265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	19958095, 24220567, 25595671, 27383213, 30886013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	22766684, 26994298, 26994299, 27084887, 27886414, 28245765, 28776455, 28977676, 29500688, 29536279, 29785578, 30088106, 30799680, 30983973, 31299857, 31449829, 31714319, 31810401 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miosis disorder	Miosis Disorder	CTD_human_DG	8637627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	37226771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16888145, 16951196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17175032, 30058008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	39201536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	9973484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	20378996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10867818, 12732341, 14742913, 16951196, 26454744, 28342098, 29935235, 8721987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	25758343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	25758343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	28759637		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31284862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10529624, 15518890, 17995938, 18048093, 18506635, 19269029, 19712974, 29699729, 31401178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	1321043, 7913440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23466699, 29230633, 30246634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	24220567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	16888199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30273693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15054836		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	30935267, 31039374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	17962362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	17962362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	17962362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	29249830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27566169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	12067490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23625270, 26769362, 28067625, 29230633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	12573802, 18048093, 20483910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	BEFREE	12573802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	10595920, 9846969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	30259317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	21350482, 24220567, 24516127, 25636177, 25680674, 28057459, 28746747, 29353055, 30458282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	30345481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11728828, 12839880, 16372333, 16888207, 9566707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12639948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12839880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16888207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	10235634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	37226771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28335564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10583729, 11166332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11515750, 17387318, 17664024, 19914336, 19958095, 20414143, 24220567, 25595671, 27383213, 27900577, 28125634, 30886013		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17387318		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20144662, 22843252, 23268987, 24586556		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	31601840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	29673861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29212793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	8761002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	21517111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25612142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	Pubtator	21738391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	25758343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	25758343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27566169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	29673861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	19914336, 25595671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26552048, 26768780, 37830980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	29673861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	15543094		★★★★★ ★☆☆☆☆ Found in Text Mining only

ADCYAP1 (adenylate cyclase activating polypeptide 1)