Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	115992
Gene name	Ring finger protein 166
Gene symbol	RNF166
Synonyms (NCBI Gene)	-
Chromosome	16
Chromosome location	16q24.2-q24.3

Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT723709	hsa-miR-6736-3p	HITS-CLIP	19536157
MIRT723708	hsa-miR-4660	HITS-CLIP	19536157
MIRT723707	hsa-miR-6820-5p	HITS-CLIP	19536157
MIRT723706	hsa-miR-7977	HITS-CLIP	19536157
MIRT723709	hsa-miR-6736-3p	HITS-CLIP	19536157
MIRT723708	hsa-miR-4660	HITS-CLIP	19536157
MIRT723707	hsa-miR-6820-5p	HITS-CLIP	19536157
MIRT723706	hsa-miR-7977	HITS-CLIP	19536157
MIRT1310953	hsa-miR-25	CLIP-seq
MIRT1310954	hsa-miR-3120-5p	CLIP-seq
MIRT1310955	hsa-miR-3194-3p	CLIP-seq
MIRT1310956	hsa-miR-32	CLIP-seq
MIRT1310957	hsa-miR-363	CLIP-seq
MIRT1310958	hsa-miR-367	CLIP-seq
MIRT1310959	hsa-miR-384	CLIP-seq
MIRT1310960	hsa-miR-4517	CLIP-seq
MIRT1310961	hsa-miR-4709-3p	CLIP-seq
MIRT1310962	hsa-miR-4795-3p	CLIP-seq
MIRT1310963	hsa-miR-511	CLIP-seq
MIRT1310964	hsa-miR-92a	CLIP-seq
MIRT1310965	hsa-miR-92b	CLIP-seq
MIRT1310966	hsa-miR-296-5p	CLIP-seq
MIRT1310955	hsa-miR-3194-3p	CLIP-seq
MIRT1310967	hsa-miR-409-3p	CLIP-seq
MIRT1310968	hsa-miR-4258	CLIP-seq
MIRT1310969	hsa-miR-4423-5p	CLIP-seq
MIRT1310970	hsa-miR-4707-3p	CLIP-seq
MIRT1310971	hsa-miR-1243	CLIP-seq
MIRT1310972	hsa-miR-1261	CLIP-seq
MIRT1310953	hsa-miR-25	CLIP-seq
MIRT1310954	hsa-miR-3120-5p	CLIP-seq
MIRT1310973	hsa-miR-3163	CLIP-seq
MIRT1310955	hsa-miR-3194-3p	CLIP-seq
MIRT1310956	hsa-miR-32	CLIP-seq
MIRT1310957	hsa-miR-363	CLIP-seq
MIRT1310958	hsa-miR-367	CLIP-seq
MIRT1310959	hsa-miR-384	CLIP-seq
MIRT1310962	hsa-miR-4795-3p	CLIP-seq
MIRT1310963	hsa-miR-511	CLIP-seq
MIRT1310974	hsa-miR-548ad	CLIP-seq
MIRT1310975	hsa-miR-548c-3p	CLIP-seq
MIRT1310976	hsa-miR-587	CLIP-seq
MIRT1310964	hsa-miR-92a	CLIP-seq
MIRT1310965	hsa-miR-92b	CLIP-seq
MIRT2092281	hsa-miR-2052	CLIP-seq
MIRT2092282	hsa-miR-219-5p	CLIP-seq
MIRT2092283	hsa-miR-361-3p	CLIP-seq
MIRT2092284	hsa-miR-4445	CLIP-seq
MIRT2092285	hsa-miR-4782-3p	CLIP-seq
MIRT2092286	hsa-miR-508-3p	CLIP-seq
MIRT2316950	hsa-miR-3192	CLIP-seq
MIRT2316951	hsa-miR-4300	CLIP-seq
MIRT2316952	hsa-miR-4691-3p	CLIP-seq
MIRT2316953	hsa-miR-4731-5p	CLIP-seq
MIRT2316954	hsa-miR-920	CLIP-seq
MIRT2612839	hsa-miR-2467-5p	CLIP-seq
MIRT2612840	hsa-miR-3127-3p	CLIP-seq
MIRT2612841	hsa-miR-4707-5p	CLIP-seq
MIRT2612839	hsa-miR-2467-5p	CLIP-seq
MIRT2612840	hsa-miR-3127-3p	CLIP-seq
MIRT2612841	hsa-miR-4707-5p	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	19549727, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006914	Process	Autophagy	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
617178	28856	ENSG00000158717

Q96A37

Protein name

E3 ubiquitin-protein ligase RNF166 (EC 2.3.2.27) (RING finger protein 166) (RING-type E3 ubiquitin transferase RNF166)

Protein function

E3 ubiquitin-protein ligase that promotes the ubiquitination of different substrates (PubMed:27880896). In turn, participates in different biological processes including interferon production or autophagy (PubMed:26456228, PubMed:27880896). Play

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13923	zf-C3HC4_2	32 → 72		Domain
PF18574	zf_C2HC_14	92 → 124	C2HC Zing finger domain	Domain
PF05605	zf-Di19	148 → 209	Drought induced 19 protein (Di19), zinc-binding	Domain

Sequence

MAMFRSLVASAQQRQPPAGPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQP
CLQVPSPLCPLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKV
QEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRV
VCPICSAMPWGDPSYKSANFLQHLLHRHKFSYDTFVDYSIDEEAAFQAALALSLSEN

Sequence length

237

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atrial Fibrillation	Atrial fibrillation	Pubtator	36952494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36952494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF166 (ring finger protein 166)