Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	115703
Gene name	Rho GTPase activating protein 33
Gene symbol	ARHGAP33
Synonyms (NCBI Gene)	NOMA-GAPSNX26TCGAP
Chromosome	19
Chromosome location	19q13.12
Summary	This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. Alternative splice variants encoding different isoforms h

Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041421	hsa-miR-193b-3p	CLASH	23622248
MIRT794627	hsa-miR-1293	CLIP-seq
MIRT794628	hsa-miR-140-5p	CLIP-seq
MIRT794629	hsa-miR-147b	CLIP-seq
MIRT794630	hsa-miR-1973	CLIP-seq
MIRT794631	hsa-miR-210	CLIP-seq
MIRT794632	hsa-miR-2110	CLIP-seq
MIRT794633	hsa-miR-2113	CLIP-seq
MIRT794634	hsa-miR-2392	CLIP-seq
MIRT794635	hsa-miR-296-5p	CLIP-seq
MIRT794636	hsa-miR-299-3p	CLIP-seq
MIRT794637	hsa-miR-3151	CLIP-seq
MIRT794638	hsa-miR-3153	CLIP-seq
MIRT794639	hsa-miR-3154	CLIP-seq
MIRT794640	hsa-miR-3545-5p	CLIP-seq
MIRT794641	hsa-miR-361-3p	CLIP-seq
MIRT794642	hsa-miR-4253	CLIP-seq
MIRT794643	hsa-miR-4271	CLIP-seq
MIRT794644	hsa-miR-4436a	CLIP-seq
MIRT794645	hsa-miR-4447	CLIP-seq
MIRT794646	hsa-miR-4460	CLIP-seq
MIRT794647	hsa-miR-4472	CLIP-seq
MIRT794648	hsa-miR-4483	CLIP-seq
MIRT794649	hsa-miR-4525	CLIP-seq
MIRT794650	hsa-miR-4534	CLIP-seq
MIRT794651	hsa-miR-4646-3p	CLIP-seq
MIRT794652	hsa-miR-4725-3p	CLIP-seq
MIRT794653	hsa-miR-4737	CLIP-seq
MIRT794654	hsa-miR-4802-5p	CLIP-seq
MIRT794655	hsa-miR-486-3p	CLIP-seq
MIRT794656	hsa-miR-490-3p	CLIP-seq
MIRT794657	hsa-miR-491-5p	CLIP-seq
MIRT794658	hsa-miR-541	CLIP-seq
MIRT794659	hsa-miR-654-5p	CLIP-seq
MIRT794660	hsa-miR-3690	CLIP-seq
MIRT794661	hsa-miR-4254	CLIP-seq
MIRT794662	hsa-miR-4283	CLIP-seq
MIRT794663	hsa-miR-4419a	CLIP-seq
MIRT794664	hsa-miR-4488	CLIP-seq
MIRT794665	hsa-miR-4510	CLIP-seq
MIRT794666	hsa-miR-4697-5p	CLIP-seq
MIRT794667	hsa-miR-4731-5p	CLIP-seq
MIRT794668	hsa-miR-637	CLIP-seq
MIRT794628	hsa-miR-140-5p	CLIP-seq
MIRT794640	hsa-miR-3545-5p	CLIP-seq
MIRT794646	hsa-miR-4460	CLIP-seq
MIRT794656	hsa-miR-490-3p	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IBA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	16777849
GO:0005654	Component	Nucleoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IBA
GO:0009636	Process	Response to toxic substance	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0015031	Process	Protein transport	IEA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0019901	Function	Protein kinase binding	IPI	20873783
GO:0032991	Component	Protein-containing complex	IDA	20873783
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0061001	Process	Regulation of dendritic spine morphogenesis	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA

MIM	HGNC	e!Ensembl
614902	23085	ENSG00000004777

O14559

Protein name

Rho GTPase-activating protein 33 (Rho-type GTPase-activating protein 33) (Sorting nexin-26) (Tc10/CDC42 GTPase-activating protein)

Protein function

May be involved in several stages of intracellular trafficking. Could play an important role in the regulation of glucose transport by insulin. May act as a downstream effector of RHOQ/TC10 in the regulation of insulin-stimulated glucose transpo

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14604	SH3_9	193 → 244	Variant SH3 domain	Domain
PF00620	RhoGAP	329 → 480	RhoGAP domain	Domain

Sequence

MVARSTDSLDGPGEGSVQPLPTAGGPSVKGKPGKRLSAPRGPFPRLADCAHFHYENVDFG
HIQLLLSPDREGPSLSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDAHLHRCIFDRRFS
CLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGRRLLLSEE
ASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWRGKRGFQVGFFPS
ECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQ
RLRQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCSEFIEAHGVVDGIYRLSGVSSNIQR
LRHEFDSERIPELSGPAFLQDIHSVSSLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEEE
RLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAPNLLRSMELES
VGMGGAAAFREVRVQSVVVEFLLTHVDVLFSDTFTSAGLDPAGRCLLPRPKSLAGSCPST
RLLTLEEAQARTQGRLGTPTEPTTPKAPASPAERRKGERGEKQRKPGGSSWKTFFALGRG
PSVPRKKPLPWLGGTRAPPQPSGSRPDTVTLRSAKSEESLSSQASGAGLQRLHRLRRPHS
SSDAFPVGPAPAGSCESLSSSSSSESSSSESSSSSSESSAAGLGALSGSPSHRTSAWLDD
GDELDFSPPRCLEGLRGLDFDPLTFRCSSPTPGDPAPPASPAPPAPASAFPPRVTPQAIS
PRGPTSPASPAALDISEPLAVSVPPAVLELLGAGGAPASATPTPALSPGRSLRPHLIPLL
LRGAEAPLTDACQQEMCSKLRGAQGPLGPDMESPLPPPPLSLLRPGGAPPPPPKNPARLM
ALALAERAQQVAEQQSQQECGGTPPASQSPFHRSLSLEVGGEPLGTSGSGPPPNSLAHPG
AWVPGPPPYLPRQQSDGSLLRSQRPMGTSRRGLRGPAQVSAQLRAGGGGRDAPEAAAQSP
CSVPSQVPTPGFFSPAPRECLPPFLGVPKPGLYPLGPPSFQPSSPAPVWRSSLGPPAPLD
RGENLYYEIGASEGSPYSGPTRSWSPFRSMPPDRLNASYGMLGQSPPLHRSPDFLLSYPP
APSCFPPDHLGYSAPQHPARRPTPPEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPG
PPVPRLPQKQRAPWGPRTPHRVPGPWGPPEPLLLYRAAPPAYGRGGELHRGSLYRNGGQR
GEGAGPPPPYPTPSWSLHSEGQTRSYC

Sequence length

1287

Interactions

View interactions

	Reactome
			Rho GTPase cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autistic Disorder	Autism	Pubtator	33893496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	26839058		★★★★★ ★☆☆☆☆ Found in Text Mining only

ARHGAP33 (Rho GTPase activating protein 33)