Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	115426
Gene name	Ubiquitin like with PHD and ring finger domains 2
Gene symbol	UHRF2
Synonyms (NCBI Gene)	NIRFRNF107TDRD23URF2
Chromosome	9
Chromosome location	9p24.1
Summary	This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded prote

123

Show/Hide all (123)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004321	hsa-let-7a-5p	qRT-PCRWestern blot	19818775
MIRT004321	hsa-let-7a-5p	Luciferase reporter assay	19818775
MIRT018641	hsa-miR-335-5p	Microarray	18185580
MIRT028675	hsa-miR-30a-5p	Proteomics	18668040
MIRT046615	hsa-miR-222-3p	CLASH	23622248
MIRT1474490	hsa-let-7a	CLIP-seq
MIRT1474491	hsa-let-7b	CLIP-seq
MIRT1474492	hsa-let-7c	CLIP-seq
MIRT1474493	hsa-let-7d	CLIP-seq
MIRT1474494	hsa-let-7e	CLIP-seq
MIRT1474495	hsa-let-7f	CLIP-seq
MIRT1474496	hsa-let-7g	CLIP-seq
MIRT1474497	hsa-let-7i	CLIP-seq
MIRT1474498	hsa-miR-1184	CLIP-seq
MIRT1474499	hsa-miR-1200	CLIP-seq
MIRT1474500	hsa-miR-1205	CLIP-seq
MIRT1474501	hsa-miR-130a	CLIP-seq
MIRT1474502	hsa-miR-130b	CLIP-seq
MIRT1474503	hsa-miR-1323	CLIP-seq
MIRT1474504	hsa-miR-196a	CLIP-seq
MIRT1474505	hsa-miR-196b	CLIP-seq
MIRT1474506	hsa-miR-19a	CLIP-seq
MIRT1474507	hsa-miR-19b	CLIP-seq
MIRT1474508	hsa-miR-202	CLIP-seq
MIRT1474509	hsa-miR-301a	CLIP-seq
MIRT1474510	hsa-miR-301b	CLIP-seq
MIRT1474511	hsa-miR-302a	CLIP-seq
MIRT1474512	hsa-miR-302b	CLIP-seq
MIRT1474513	hsa-miR-302c	CLIP-seq
MIRT1474514	hsa-miR-302d	CLIP-seq
MIRT1474515	hsa-miR-302e	CLIP-seq
MIRT1474516	hsa-miR-3065-3p	CLIP-seq
MIRT1474517	hsa-miR-3117-5p	CLIP-seq
MIRT1474518	hsa-miR-3145-3p	CLIP-seq
MIRT1474519	hsa-miR-3158-5p	CLIP-seq
MIRT1474520	hsa-miR-3666	CLIP-seq
MIRT1474521	hsa-miR-371b-5p	CLIP-seq
MIRT1474522	hsa-miR-372	CLIP-seq
MIRT1474523	hsa-miR-373	CLIP-seq
MIRT1474524	hsa-miR-4269	CLIP-seq
MIRT1474525	hsa-miR-4286	CLIP-seq
MIRT1474526	hsa-miR-4295	CLIP-seq
MIRT1474527	hsa-miR-4299	CLIP-seq
MIRT1474528	hsa-miR-4324	CLIP-seq
MIRT1474529	hsa-miR-4458	CLIP-seq
MIRT1474530	hsa-miR-4495	CLIP-seq
MIRT1474531	hsa-miR-4500	CLIP-seq
MIRT1474532	hsa-miR-454	CLIP-seq
MIRT1474533	hsa-miR-455-3p	CLIP-seq
MIRT1474534	hsa-miR-4645-5p	CLIP-seq
MIRT1474535	hsa-miR-4652-3p	CLIP-seq
MIRT1474536	hsa-miR-4659a-3p	CLIP-seq
MIRT1474537	hsa-miR-4659b-3p	CLIP-seq
MIRT1474538	hsa-miR-4673	CLIP-seq
MIRT1474539	hsa-miR-4684-3p	CLIP-seq
MIRT1474540	hsa-miR-4687-5p	CLIP-seq
MIRT1474541	hsa-miR-4703-3p	CLIP-seq
MIRT1474542	hsa-miR-4710	CLIP-seq
MIRT1474543	hsa-miR-4760-5p	CLIP-seq
MIRT1474544	hsa-miR-4792	CLIP-seq
MIRT1474545	hsa-miR-518a-5p	CLIP-seq
MIRT1474546	hsa-miR-519a	CLIP-seq
MIRT1474547	hsa-miR-519b-3p	CLIP-seq
MIRT1474548	hsa-miR-519c-3p	CLIP-seq
MIRT1474549	hsa-miR-520a-3p	CLIP-seq
MIRT1474550	hsa-miR-520b	CLIP-seq
MIRT1474551	hsa-miR-520c-3p	CLIP-seq
MIRT1474552	hsa-miR-520d-3p	CLIP-seq
MIRT1474553	hsa-miR-520e	CLIP-seq
MIRT1474554	hsa-miR-527	CLIP-seq
MIRT1474555	hsa-miR-544b	CLIP-seq
MIRT1474556	hsa-miR-548aa	CLIP-seq
MIRT1474557	hsa-miR-548b-3p	CLIP-seq
MIRT1474558	hsa-miR-548o	CLIP-seq
MIRT1474559	hsa-miR-660	CLIP-seq
MIRT1474560	hsa-miR-98	CLIP-seq
MIRT2142807	hsa-miR-1290	CLIP-seq
MIRT2142808	hsa-miR-1827	CLIP-seq
MIRT2142809	hsa-miR-2682	CLIP-seq
MIRT2142810	hsa-miR-3122	CLIP-seq
MIRT2142811	hsa-miR-3129-3p	CLIP-seq
MIRT2142812	hsa-miR-3167	CLIP-seq
MIRT2142813	hsa-miR-34a	CLIP-seq
MIRT2142814	hsa-miR-34c-5p	CLIP-seq
MIRT2142815	hsa-miR-3612	CLIP-seq
MIRT2142816	hsa-miR-3681	CLIP-seq
MIRT2142817	hsa-miR-3689a-3p	CLIP-seq
MIRT2142818	hsa-miR-3689c	CLIP-seq
MIRT2142819	hsa-miR-3913-5p	CLIP-seq
MIRT2142820	hsa-miR-4282	CLIP-seq
MIRT2142821	hsa-miR-4302	CLIP-seq
MIRT2142822	hsa-miR-433	CLIP-seq
MIRT2142823	hsa-miR-449a	CLIP-seq
MIRT2142824	hsa-miR-449b	CLIP-seq
MIRT2142825	hsa-miR-449c	CLIP-seq
MIRT1474533	hsa-miR-455-3p	CLIP-seq
MIRT1474536	hsa-miR-4659a-3p	CLIP-seq
MIRT1474537	hsa-miR-4659b-3p	CLIP-seq
MIRT2142826	hsa-miR-4728-5p	CLIP-seq
MIRT2142827	hsa-miR-513a-3p	CLIP-seq
MIRT1474545	hsa-miR-518a-5p	CLIP-seq
MIRT1474554	hsa-miR-527	CLIP-seq
MIRT2142828	hsa-miR-650	CLIP-seq
MIRT2142829	hsa-miR-876-5p	CLIP-seq
MIRT2363167	hsa-miR-22	CLIP-seq
MIRT2363168	hsa-miR-299-3p	CLIP-seq
MIRT2363169	hsa-miR-3153	CLIP-seq
MIRT2363170	hsa-miR-3159	CLIP-seq
MIRT2363171	hsa-miR-3977	CLIP-seq
MIRT2363172	hsa-miR-4491	CLIP-seq
MIRT2363173	hsa-miR-4648	CLIP-seq
MIRT2363174	hsa-miR-4654	CLIP-seq
MIRT2363175	hsa-miR-4657	CLIP-seq
MIRT2363176	hsa-miR-4668-5p	CLIP-seq
MIRT2363177	hsa-miR-4769-5p	CLIP-seq
MIRT2363178	hsa-miR-583	CLIP-seq
MIRT2462889	hsa-miR-3646	CLIP-seq
MIRT2462890	hsa-miR-3662	CLIP-seq
MIRT1474525	hsa-miR-4286	CLIP-seq
MIRT1474536	hsa-miR-4659a-3p	CLIP-seq
MIRT1474537	hsa-miR-4659b-3p	CLIP-seq
MIRT2462891	hsa-miR-649	CLIP-seq
MIRT1474559	hsa-miR-660	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000792	Component	Heterochromatin	IEA
GO:0000792	Component	Heterochromatin	ISS
GO:0003677	Function	DNA binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	14741369
GO:0005515	Function	Protein binding	IPI	12176013, 15178429, 21952639, 32296183
GO:0005634	Component	Nucleus	IDA	12176013
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005721	Component	Pericentric heterochromatin	IDA	27129234
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	27129234
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IDA	14741369
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016925	Process	Protein sumoylation	TAS
GO:0019789	Function	SUMO transferase activity	EXP	22467880, 23404503
GO:0030154	Process	Cell differentiation	IEP	12176013
GO:0042393	Function	Histone binding	IEA
GO:0042393	Function	Histone binding	ISS
GO:0044027	Process	Negative regulation of gene expression via chromosomal CpG island methylation	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	15178429
GO:0051726	Process	Regulation of cell cycle	TAS	14741369
GO:0051865	Process	Protein autoubiquitination	IDA	14741369
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	27129234
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	14741369
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0062072	Function	Histone H3K9me2/3 reader activity	TAS	27129234

MIM	HGNC	e!Ensembl
615211	12557	ENSG00000147854

Q96PU4

Protein name

E3 ubiquitin-protein ligase UHRF2 (EC 2.3.2.27) (Np95/ICBP90-like RING finger protein) (Np95-like RING finger protein) (Nuclear protein 97) (Nuclear zinc finger protein Np97) (RING finger protein 107) (RING-type E3 ubiquitin transferase UHRF2) (Ubiquitin-

Protein function

E3 ubiquitin ligase that plays important roles in DNA methylation, histone modifications, cell cycle and DNA repair (PubMed:15178429, PubMed:23404503, PubMed:27743347, PubMed:29506131). Acts as a specific reader for 5-hydroxymethylcytosine (5hmC

PDB

1WY8 , 1Z6U , 2E6S , 3OLN , 4PW5 , 4PW6 , 4PW7 , 4TVR , 5YCO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	3 → 76	Ubiquitin family	Domain
PF12148	TTD	124 → 312	Tandem tudor domain within UHRF1	Domain
PF00628	PHD	346 → 395	PHD-finger	Domain
PF02182	SAD_SRA	446 → 616	SAD/SRA domain	Domain

Sequence

MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFD
YDVGLNDIIQLLVRPDPDHLPGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLI
DPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
KSKENTNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRARTILKWN
ELNVGDVVMVNYNVESPGQRGFWFDAEITTLKTISRTKKELRVKIFLGGSEGTLNDCKII
SVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQL
LCDECNVAYHIYCLNPPLDKVPEEEYWYCPSCKTDSSEVVKAGERLKMSKKKAKMPSAST
ESRRDWGRGMACVGRTRECTIVPSNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGIHG
RSNDGAYSLVLAGGFADEVDRGDEFTYTGSGGKNLAGNKRIGAPSADQTLTNMNRALALN
CDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEISSS
HGFLVWRYLLRRDDVEPAPWTSEGIERSRRLCLRLQYPAGYPSDKEGKKPKGQSKKQPSG
TTKRPISDDDCPSASKVYKASDSAEAIEAFQLTPQQQHLIREDCQNQKLWDEVLSHLVEG
PNFLKKLEQSFMCVCCQELVYQPVTTECFHNVCKDCLQRSFKAQVFSCPACRHDLGQNYI
MIPNEILQTLLDLFFPGYSKGR

Sequence length

802

Interactions

View interactions

	Reactome
			SUMOylation of transcription cofactors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (33)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	31388807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	31619474		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29992622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21666724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21666724, 23244124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21952639, 23244124, 28004105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38556072	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28004105, 37356603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34400880	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21952639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21952639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23244124	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23244124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23244124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29270024		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27738314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27738314	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28004105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23244124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21666724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30172243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30468220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21952639, 27743347, 30210621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21952639, 22673569, 27738314, 27842504, 28352173, 28448604, 30210621, 31525534, 31769770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28900727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30210621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30172243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30468220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29909415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31450798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27114453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	38556072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

UHRF2 (ubiquitin like with PHD and ring finger domains 2)