Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1154
Gene name	Cytokine inducible SH2 containing protein
Gene symbol	CISH
Synonyms (NCBI Gene)	BACTS2CISCIS-1G18SOCS
Chromosome	3
Chromosome location	3p21.2
Summary	The protein encoded by this gene contains a SH2 domain and a SOCS box domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family

277

Show/Hide all (277)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029522	hsa-miR-26b-5p	Microarray	19088304
MIRT054146	hsa-miR-92a-1-5p	MicroarrayqRT-PCR	22660396
MIRT437917	hsa-miR-150-5p	Luciferase reporter assayWestern blot	23723424
MIRT437917	hsa-miR-150-5p	Luciferase reporter assayWestern blottingqRT-PCR	34027272
MIRT893792	hsa-miR-125a-3p	CLIP-seq
MIRT893793	hsa-miR-1266	CLIP-seq
MIRT893794	hsa-miR-1276	CLIP-seq
MIRT893795	hsa-miR-135a	CLIP-seq
MIRT893796	hsa-miR-135b	CLIP-seq
MIRT893797	hsa-miR-181a	CLIP-seq
MIRT893798	hsa-miR-181b	CLIP-seq
MIRT893799	hsa-miR-181c	CLIP-seq
MIRT893800	hsa-miR-181d	CLIP-seq
MIRT893801	hsa-miR-2392	CLIP-seq
MIRT893802	hsa-miR-2467-5p	CLIP-seq
MIRT893803	hsa-miR-27a	CLIP-seq
MIRT893804	hsa-miR-27b	CLIP-seq
MIRT893805	hsa-miR-296-5p	CLIP-seq
MIRT893806	hsa-miR-298	CLIP-seq
MIRT893807	hsa-miR-3138	CLIP-seq
MIRT893808	hsa-miR-3144-5p	CLIP-seq
MIRT893809	hsa-miR-3155	CLIP-seq
MIRT893810	hsa-miR-3155b	CLIP-seq
MIRT893811	hsa-miR-3188	CLIP-seq
MIRT893812	hsa-miR-3191	CLIP-seq
MIRT893813	hsa-miR-3194-3p	CLIP-seq
MIRT893814	hsa-miR-3199	CLIP-seq
MIRT893815	hsa-miR-338-3p	CLIP-seq
MIRT893816	hsa-miR-3652	CLIP-seq
MIRT893817	hsa-miR-3664-3p	CLIP-seq
MIRT893818	hsa-miR-3692	CLIP-seq
MIRT893819	hsa-miR-3975	CLIP-seq
MIRT893820	hsa-miR-4262	CLIP-seq
MIRT893821	hsa-miR-4311	CLIP-seq
MIRT893822	hsa-miR-4312	CLIP-seq
MIRT893823	hsa-miR-4430	CLIP-seq
MIRT893824	hsa-miR-4438	CLIP-seq
MIRT893825	hsa-miR-4488	CLIP-seq
MIRT893826	hsa-miR-4505	CLIP-seq
MIRT893827	hsa-miR-4518	CLIP-seq
MIRT893828	hsa-miR-451b	CLIP-seq
MIRT893829	hsa-miR-4530	CLIP-seq
MIRT893830	hsa-miR-4649-3p	CLIP-seq
MIRT893831	hsa-miR-4652-5p	CLIP-seq
MIRT893832	hsa-miR-4667-5p	CLIP-seq
MIRT893833	hsa-miR-4690-3p	CLIP-seq
MIRT893834	hsa-miR-4693-3p	CLIP-seq
MIRT893835	hsa-miR-4697-5p	CLIP-seq
MIRT893836	hsa-miR-4700-5p	CLIP-seq
MIRT893837	hsa-miR-4731-5p	CLIP-seq
MIRT893838	hsa-miR-4740-5p	CLIP-seq
MIRT893839	hsa-miR-483-5p	CLIP-seq
MIRT893840	hsa-miR-484	CLIP-seq
MIRT893841	hsa-miR-485-5p	CLIP-seq
MIRT893842	hsa-miR-486-3p	CLIP-seq
MIRT893843	hsa-miR-513a-5p	CLIP-seq
MIRT893844	hsa-miR-548b-3p	CLIP-seq
MIRT893845	hsa-miR-548m	CLIP-seq
MIRT893846	hsa-miR-552	CLIP-seq
MIRT893847	hsa-miR-583	CLIP-seq
MIRT893848	hsa-miR-624	CLIP-seq
MIRT893849	hsa-miR-637	CLIP-seq
MIRT893850	hsa-miR-642b	CLIP-seq
MIRT893851	hsa-miR-659	CLIP-seq
MIRT893852	hsa-miR-665	CLIP-seq
MIRT893853	hsa-miR-760	CLIP-seq
MIRT1964976	hsa-miR-1236	CLIP-seq
MIRT1964977	hsa-miR-1254	CLIP-seq
MIRT893793	hsa-miR-1266	CLIP-seq
MIRT893794	hsa-miR-1276	CLIP-seq
MIRT1964978	hsa-miR-1343	CLIP-seq
MIRT893795	hsa-miR-135a	CLIP-seq
MIRT893796	hsa-miR-135b	CLIP-seq
MIRT1964979	hsa-miR-149	CLIP-seq
MIRT1964980	hsa-miR-150	CLIP-seq
MIRT893797	hsa-miR-181a	CLIP-seq
MIRT893798	hsa-miR-181b	CLIP-seq
MIRT893799	hsa-miR-181c	CLIP-seq
MIRT893800	hsa-miR-181d	CLIP-seq
MIRT1964981	hsa-miR-202	CLIP-seq
MIRT1964982	hsa-miR-22	CLIP-seq
MIRT893802	hsa-miR-2467-5p	CLIP-seq
MIRT893803	hsa-miR-27a	CLIP-seq
MIRT893804	hsa-miR-27b	CLIP-seq
MIRT893806	hsa-miR-298	CLIP-seq
MIRT1964983	hsa-miR-3116	CLIP-seq
MIRT1964984	hsa-miR-3126-5p	CLIP-seq
MIRT893807	hsa-miR-3138	CLIP-seq
MIRT1964985	hsa-miR-3163	CLIP-seq
MIRT1964986	hsa-miR-3170	CLIP-seq
MIRT893811	hsa-miR-3188	CLIP-seq
MIRT1964987	hsa-miR-361-5p	CLIP-seq
MIRT893816	hsa-miR-3652	CLIP-seq
MIRT893819	hsa-miR-3975	CLIP-seq
MIRT1964988	hsa-miR-3976	CLIP-seq
MIRT1964989	hsa-miR-4254	CLIP-seq
MIRT1964990	hsa-miR-4257	CLIP-seq
MIRT1964991	hsa-miR-4259	CLIP-seq
MIRT893820	hsa-miR-4262	CLIP-seq
MIRT1964992	hsa-miR-4267	CLIP-seq
MIRT1964993	hsa-miR-4269	CLIP-seq
MIRT893821	hsa-miR-4311	CLIP-seq
MIRT893822	hsa-miR-4312	CLIP-seq
MIRT893823	hsa-miR-4430	CLIP-seq
MIRT1964994	hsa-miR-4436b-3p	CLIP-seq
MIRT893825	hsa-miR-4488	CLIP-seq
MIRT893826	hsa-miR-4505	CLIP-seq
MIRT893827	hsa-miR-4518	CLIP-seq
MIRT1964995	hsa-miR-4685-5p	CLIP-seq
MIRT893834	hsa-miR-4693-3p	CLIP-seq
MIRT893835	hsa-miR-4697-5p	CLIP-seq
MIRT1964996	hsa-miR-4713-5p	CLIP-seq
MIRT893837	hsa-miR-4731-5p	CLIP-seq
MIRT1964997	hsa-miR-4733-3p	CLIP-seq
MIRT1964998	hsa-miR-4779	CLIP-seq
MIRT1964999	hsa-miR-4786-3p	CLIP-seq
MIRT1965000	hsa-miR-4795-3p	CLIP-seq
MIRT893839	hsa-miR-483-5p	CLIP-seq
MIRT893841	hsa-miR-485-5p	CLIP-seq
MIRT893842	hsa-miR-486-3p	CLIP-seq
MIRT893843	hsa-miR-513a-5p	CLIP-seq
MIRT1965001	hsa-miR-532-3p	CLIP-seq
MIRT1965002	hsa-miR-532-5p	CLIP-seq
MIRT893845	hsa-miR-548m	CLIP-seq
MIRT1965003	hsa-miR-571	CLIP-seq
MIRT893847	hsa-miR-583	CLIP-seq
MIRT1965004	hsa-miR-615-5p	CLIP-seq
MIRT893849	hsa-miR-637	CLIP-seq
MIRT893850	hsa-miR-642b	CLIP-seq
MIRT1965005	hsa-miR-661	CLIP-seq
MIRT893853	hsa-miR-760	CLIP-seq
MIRT1965006	hsa-miR-765	CLIP-seq
MIRT2201004	hsa-miR-1200	CLIP-seq
MIRT2201005	hsa-miR-1234	CLIP-seq
MIRT1964976	hsa-miR-1236	CLIP-seq
MIRT893793	hsa-miR-1266	CLIP-seq
MIRT2201006	hsa-miR-1285	CLIP-seq
MIRT1964978	hsa-miR-1343	CLIP-seq
MIRT893795	hsa-miR-135a	CLIP-seq
MIRT893796	hsa-miR-135b	CLIP-seq
MIRT1964979	hsa-miR-149	CLIP-seq
MIRT1964980	hsa-miR-150	CLIP-seq
MIRT893797	hsa-miR-181a	CLIP-seq
MIRT893798	hsa-miR-181b	CLIP-seq
MIRT893799	hsa-miR-181c	CLIP-seq
MIRT893800	hsa-miR-181d	CLIP-seq
MIRT1964982	hsa-miR-22	CLIP-seq
MIRT2201007	hsa-miR-2277-3p	CLIP-seq
MIRT893801	hsa-miR-2392	CLIP-seq
MIRT2201008	hsa-miR-24	CLIP-seq
MIRT893802	hsa-miR-2467-5p	CLIP-seq
MIRT893803	hsa-miR-27a	CLIP-seq
MIRT893804	hsa-miR-27b	CLIP-seq
MIRT893806	hsa-miR-298	CLIP-seq
MIRT2201009	hsa-miR-3065-3p	CLIP-seq
MIRT2201010	hsa-miR-3127-5p	CLIP-seq
MIRT893807	hsa-miR-3138	CLIP-seq
MIRT893808	hsa-miR-3144-5p	CLIP-seq
MIRT1964986	hsa-miR-3170	CLIP-seq
MIRT2201011	hsa-miR-3183	CLIP-seq
MIRT2201012	hsa-miR-3187-5p	CLIP-seq
MIRT893811	hsa-miR-3188	CLIP-seq
MIRT2201013	hsa-miR-3190	CLIP-seq
MIRT893812	hsa-miR-3191	CLIP-seq
MIRT893814	hsa-miR-3199	CLIP-seq
MIRT2201014	hsa-miR-326	CLIP-seq
MIRT2201015	hsa-miR-330-5p	CLIP-seq
MIRT893815	hsa-miR-338-3p	CLIP-seq
MIRT2201016	hsa-miR-3607-5p	CLIP-seq
MIRT1964987	hsa-miR-361-5p	CLIP-seq
MIRT893816	hsa-miR-3652	CLIP-seq
MIRT2201017	hsa-miR-3660	CLIP-seq
MIRT893817	hsa-miR-3664-3p	CLIP-seq
MIRT2201018	hsa-miR-3667-3p	CLIP-seq
MIRT893818	hsa-miR-3692	CLIP-seq
MIRT2201019	hsa-miR-378	CLIP-seq
MIRT2201020	hsa-miR-378b	CLIP-seq
MIRT2201021	hsa-miR-378c	CLIP-seq
MIRT2201022	hsa-miR-378d	CLIP-seq
MIRT2201023	hsa-miR-378e	CLIP-seq
MIRT2201024	hsa-miR-378f	CLIP-seq
MIRT2201025	hsa-miR-378h	CLIP-seq
MIRT2201026	hsa-miR-378i	CLIP-seq
MIRT2201027	hsa-miR-3918	CLIP-seq
MIRT2201028	hsa-miR-3945	CLIP-seq
MIRT893819	hsa-miR-3975	CLIP-seq
MIRT2201029	hsa-miR-422a	CLIP-seq
MIRT1964991	hsa-miR-4259	CLIP-seq
MIRT893820	hsa-miR-4262	CLIP-seq
MIRT2201030	hsa-miR-4264	CLIP-seq
MIRT1964993	hsa-miR-4269	CLIP-seq
MIRT2201031	hsa-miR-4277	CLIP-seq
MIRT2201032	hsa-miR-4279	CLIP-seq
MIRT2201033	hsa-miR-4284	CLIP-seq
MIRT893822	hsa-miR-4312	CLIP-seq
MIRT2201034	hsa-miR-4326	CLIP-seq
MIRT2201035	hsa-miR-4428	CLIP-seq
MIRT893823	hsa-miR-4430	CLIP-seq
MIRT2201036	hsa-miR-4436a	CLIP-seq
MIRT1964994	hsa-miR-4436b-3p	CLIP-seq
MIRT2201037	hsa-miR-4437	CLIP-seq
MIRT893825	hsa-miR-4488	CLIP-seq
MIRT893826	hsa-miR-4505	CLIP-seq
MIRT893827	hsa-miR-4518	CLIP-seq
MIRT893828	hsa-miR-451b	CLIP-seq
MIRT2201038	hsa-miR-4526	CLIP-seq
MIRT893829	hsa-miR-4530	CLIP-seq
MIRT2201039	hsa-miR-4638-3p	CLIP-seq
MIRT2201040	hsa-miR-4640-3p	CLIP-seq
MIRT2201041	hsa-miR-4640-5p	CLIP-seq
MIRT2201042	hsa-miR-4643	CLIP-seq
MIRT893830	hsa-miR-4649-3p	CLIP-seq
MIRT893831	hsa-miR-4652-5p	CLIP-seq
MIRT893832	hsa-miR-4667-5p	CLIP-seq
MIRT1964995	hsa-miR-4685-5p	CLIP-seq
MIRT893834	hsa-miR-4693-3p	CLIP-seq
MIRT893835	hsa-miR-4697-5p	CLIP-seq
MIRT893836	hsa-miR-4700-5p	CLIP-seq
MIRT1964996	hsa-miR-4713-5p	CLIP-seq
MIRT2201043	hsa-miR-4717-3p	CLIP-seq
MIRT2201044	hsa-miR-4723-3p	CLIP-seq
MIRT2201045	hsa-miR-4726-5p	CLIP-seq
MIRT893837	hsa-miR-4731-5p	CLIP-seq
MIRT893838	hsa-miR-4740-5p	CLIP-seq
MIRT2201046	hsa-miR-4761-3p	CLIP-seq
MIRT2201047	hsa-miR-4768-5p	CLIP-seq
MIRT1964999	hsa-miR-4786-3p	CLIP-seq
MIRT2201048	hsa-miR-4793-5p	CLIP-seq
MIRT2201049	hsa-miR-4797-3p	CLIP-seq
MIRT893839	hsa-miR-483-5p	CLIP-seq
MIRT893841	hsa-miR-485-5p	CLIP-seq
MIRT893842	hsa-miR-486-3p	CLIP-seq
MIRT893843	hsa-miR-513a-5p	CLIP-seq
MIRT1965001	hsa-miR-532-3p	CLIP-seq
MIRT1965002	hsa-miR-532-5p	CLIP-seq
MIRT893844	hsa-miR-548b-3p	CLIP-seq
MIRT2201050	hsa-miR-548c-3p	CLIP-seq
MIRT1965003	hsa-miR-571	CLIP-seq
MIRT2201051	hsa-miR-593	CLIP-seq
MIRT2201052	hsa-miR-612	CLIP-seq
MIRT1965004	hsa-miR-615-5p	CLIP-seq
MIRT2201053	hsa-miR-616	CLIP-seq
MIRT893849	hsa-miR-637	CLIP-seq
MIRT893850	hsa-miR-642b	CLIP-seq
MIRT893851	hsa-miR-659	CLIP-seq
MIRT1965005	hsa-miR-661	CLIP-seq
MIRT893852	hsa-miR-665	CLIP-seq
MIRT2201054	hsa-miR-7	CLIP-seq
MIRT893853	hsa-miR-760	CLIP-seq
MIRT1964978	hsa-miR-1343	CLIP-seq
MIRT1964981	hsa-miR-202	CLIP-seq
MIRT1964982	hsa-miR-22	CLIP-seq
MIRT1964986	hsa-miR-3170	CLIP-seq
MIRT1964990	hsa-miR-4257	CLIP-seq
MIRT1964993	hsa-miR-4269	CLIP-seq
MIRT1964997	hsa-miR-4733-3p	CLIP-seq
MIRT2201013	hsa-miR-3190	CLIP-seq
MIRT2201054	hsa-miR-7	CLIP-seq
MIRT2201005	hsa-miR-1234	CLIP-seq
MIRT1964980	hsa-miR-150	CLIP-seq
MIRT2201008	hsa-miR-24	CLIP-seq
MIRT2201033	hsa-miR-4284	CLIP-seq
MIRT893822	hsa-miR-4312	CLIP-seq
MIRT2201035	hsa-miR-4428	CLIP-seq
MIRT893825	hsa-miR-4488	CLIP-seq
MIRT2201042	hsa-miR-4643	CLIP-seq
MIRT893835	hsa-miR-4697-5p	CLIP-seq
MIRT1964996	hsa-miR-4713-5p	CLIP-seq
MIRT2201043	hsa-miR-4717-3p	CLIP-seq
MIRT2678219	hsa-miR-4777-3p	CLIP-seq
MIRT1964999	hsa-miR-4786-3p	CLIP-seq
MIRT2201049	hsa-miR-4797-3p	CLIP-seq
MIRT1965001	hsa-miR-532-3p	CLIP-seq
MIRT1965002	hsa-miR-532-5p	CLIP-seq
MIRT893849	hsa-miR-637	CLIP-seq
MIRT893850	hsa-miR-642b	CLIP-seq
MIRT1965005	hsa-miR-661	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
STAT3	Activation	14630083
STAT6	Unknown	18342537

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	NAS	9465889
GO:0001960	Process	Negative regulation of cytokine-mediated signaling pathway	IEA
GO:0005126	Function	Cytokine receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	16273093, 24658140, 31980649, 32814053
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	NAS	10902923
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IBA

MIM	HGNC	e!Ensembl
602441	1984	ENSG00000114737

Q9NSE2

Protein name

Cytokine-inducible SH2-containing protein (CIS) (CIS-1) (Protein G18) (Suppressor of cytokine signaling) (SOCS)

Protein function

SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. CIS is involved in the negative regulation of cytokines that signal through the JAK-STAT5 pathway such as erythropoietin, prolact

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	82 → 163	SH2 domain	Domain
PF07525	SOCS_box	221 → 254	SOCS box	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in various epithelial tissues. Abundantly expressed in liver and kidney, and to a lesser extent in lung. The tissue distribution of isoforms 1 and 1B is distinct. {ECO:0000269|PubMed:11032736}.

Sequence

MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDC
LPLPRRMADYLRQYPFQL

Sequence length

258

Interactions

View interactions

	KEGG		Reactome
	JAK-STAT signaling pathway Prolactin signaling pathway		Interleukin-7 signaling Neddylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Bacteremia, susceptibility to, 2	risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CISH-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, susceptibility to	risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tuberculosis, susceptibility to	risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (129)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromegaly	Acromegaly	BEFREE	30343638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28295300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11561826, 29731265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31390868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28295300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	14630083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25286386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26812031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27280741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20725646, 23545584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20690084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28093225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30197185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20725646, 23545584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy of the spinal cord	Atrophy of the spinal cord	BEFREE	31385358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25207681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28144985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	31842857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23272046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12888825, 15361843, 17651480, 18254957, 18497055, 22092410, 23570400, 25104439, 26625783, 29928425, 30453988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12888825, 16446704, 18254957, 25104439, 26625783, 40003884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28693228, 7513249, 9186361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39307915	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	3022464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	20712900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23272046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20725646		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15713962, 25849377, 30072014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15713962, 25849377, 30072014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28295300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	17241887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	21082983, 24131863, 26697989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	20648401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25330801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25330801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22057237, 25025962, 29928388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22121102, 25330801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	7513249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	24791876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24703920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21054677, 24593195, 30167088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	17510435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20724312, 21352802, 28245561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	30144694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27816325, 31759286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	19118408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19118408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30942443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15757867, 16426235, 30942443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22649064, 24414000, 29228585, 31848053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	12888825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28334860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24597641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	17993720, 21987446, 30238242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29845210, 31522561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40071076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17438093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19300998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12599285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24703920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24964072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	28857282, 30148753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30179882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	20725646, 21084484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30987580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	15713962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	17634230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	20725646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	20725646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32531207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15470047, 36050244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15235874, 16310278, 16618406, 16831601, 17001312, 20648401, 23475171, 23941364, 30689554, 30941964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	20648401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	24727541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28108556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12599285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12888825, 15361843, 17651480, 18254957, 18497055, 22092410, 23570400, 25104439, 29928425, 30453988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17001312, 19342366, 28144985, 31389670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25261987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23272046, 31833718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12185365, 12888825, 15750205, 16465363, 17651480, 17989771, 17993720, 21084484, 23457134, 24460337, 25849377, 28643757, 31127170, 31406106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15713962, 25849377, 30072014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25330801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23875536		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20398276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20398276, 21081840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27816325, 31759286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	22245284, 22277297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	27280741		★★★★★ ★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	31184345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	32961483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28565861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22245284, 22277297, 28155573, 28196747, 29045421, 29299379, 29754967, 30223228, 30284401, 31319354, 31385358, 31611336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	22991927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10895017, 11278610, 11526504, 11720473, 12888825, 14681473, 15386345, 15582250, 16426581, 18056187, 21520296, 21590492, 25849377, 26527801, 26749281 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28801024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	30144694, 30284401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	15470047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	7513249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22951153, 30576246, 31717271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	24524923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24489959, 30015899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	25424734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26003293, 28643757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	17277618, 21113720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	19026878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29019549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17001312, 19342366, 28144985, 31389670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21054677, 24593195, 30167088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis	Retinitis	BEFREE	29976680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17726036, 18820827, 20690084, 28245561, 28914550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	21987446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29920655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17277618, 26191295, 29684499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32961483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20682983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25261987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31884511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	28914550		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	12607601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	9524567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	24301930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	24301930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	28643757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27622899, 28946616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	15582250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	21294722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	11278610		★★★★★ ★☆☆☆☆ Found in Text Mining only

CISH (cytokine inducible SH2 containing protein)