Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	115362
Gene name	Guanylate binding protein 5
Gene symbol	GBP5
Synonyms (NCBI Gene)	GBP-5
Chromosome	1
Chromosome location	1p22.2
Summary	This gene belongs to the TRAFAC class dynamin-like GTPase superfamily. The encoded protein acts as an activator of NLRP3 inflammasome assembly and has a role in innate immunity and inflammation. Alternative splicing results in multiple transcript variants

236

Show/Hide all (236)

miRTarBase ID	miRNA	Experiments
MIRT1014074	hsa-miR-1178	CLIP-seq
MIRT1014075	hsa-miR-147	CLIP-seq
MIRT1014076	hsa-miR-1976	CLIP-seq
MIRT1014077	hsa-miR-370	CLIP-seq
MIRT1014078	hsa-miR-3911	CLIP-seq
MIRT1014079	hsa-miR-644	CLIP-seq
MIRT1014080	hsa-miR-663b	CLIP-seq
MIRT1014081	hsa-miR-767-3p	CLIP-seq
MIRT1014082	hsa-miR-155	CLIP-seq
MIRT1014083	hsa-miR-3155	CLIP-seq
MIRT1014084	hsa-miR-3155b	CLIP-seq
MIRT1014085	hsa-miR-3670	CLIP-seq
MIRT1014086	hsa-miR-3689d	CLIP-seq
MIRT1014087	hsa-miR-4459	CLIP-seq
MIRT1014088	hsa-miR-4633-3p	CLIP-seq
MIRT1014089	hsa-miR-484	CLIP-seq
MIRT2000359	hsa-miR-3190	CLIP-seq
MIRT2000360	hsa-miR-3202	CLIP-seq
MIRT2000361	hsa-miR-3677-3p	CLIP-seq
MIRT2000362	hsa-miR-4270	CLIP-seq
MIRT2000363	hsa-miR-4441	CLIP-seq
MIRT2000364	hsa-miR-4533	CLIP-seq
MIRT2000365	hsa-miR-4642	CLIP-seq
MIRT2000366	hsa-miR-4711-5p	CLIP-seq
MIRT1014074	hsa-miR-1178	CLIP-seq
MIRT1014075	hsa-miR-147	CLIP-seq
MIRT1014076	hsa-miR-1976	CLIP-seq
MIRT1014083	hsa-miR-3155	CLIP-seq
MIRT1014084	hsa-miR-3155b	CLIP-seq
MIRT2000359	hsa-miR-3190	CLIP-seq
MIRT2000360	hsa-miR-3202	CLIP-seq
MIRT1014085	hsa-miR-3670	CLIP-seq
MIRT2000361	hsa-miR-3677-3p	CLIP-seq
MIRT1014086	hsa-miR-3689d	CLIP-seq
MIRT1014077	hsa-miR-370	CLIP-seq
MIRT1014078	hsa-miR-3911	CLIP-seq
MIRT2000362	hsa-miR-4270	CLIP-seq
MIRT2000363	hsa-miR-4441	CLIP-seq
MIRT1014087	hsa-miR-4459	CLIP-seq
MIRT2000364	hsa-miR-4533	CLIP-seq
MIRT1014088	hsa-miR-4633-3p	CLIP-seq
MIRT2000365	hsa-miR-4642	CLIP-seq
MIRT2000366	hsa-miR-4711-5p	CLIP-seq
MIRT2450139	hsa-miR-4743	CLIP-seq
MIRT1014089	hsa-miR-484	CLIP-seq
MIRT1014079	hsa-miR-644	CLIP-seq
MIRT1014080	hsa-miR-663b	CLIP-seq
MIRT1014081	hsa-miR-767-3p	CLIP-seq
MIRT1014074	hsa-miR-1178	CLIP-seq
MIRT2537672	hsa-miR-1184	CLIP-seq
MIRT2537673	hsa-miR-1205	CLIP-seq
MIRT2537674	hsa-miR-1208	CLIP-seq
MIRT2537675	hsa-miR-1227	CLIP-seq
MIRT2537676	hsa-miR-1263	CLIP-seq
MIRT2537677	hsa-miR-1265	CLIP-seq
MIRT2537678	hsa-miR-1280	CLIP-seq
MIRT2537679	hsa-miR-1286	CLIP-seq
MIRT2537680	hsa-miR-1301	CLIP-seq
MIRT2537681	hsa-miR-138	CLIP-seq
MIRT2537682	hsa-miR-146b-3p	CLIP-seq
MIRT1014075	hsa-miR-147	CLIP-seq
MIRT1014082	hsa-miR-155	CLIP-seq
MIRT2537683	hsa-miR-15a	CLIP-seq
MIRT2537684	hsa-miR-15b	CLIP-seq
MIRT2537685	hsa-miR-16	CLIP-seq
MIRT2537686	hsa-miR-1913	CLIP-seq
MIRT2537687	hsa-miR-195	CLIP-seq
MIRT1014076	hsa-miR-1976	CLIP-seq
MIRT2537688	hsa-miR-21	CLIP-seq
MIRT2537689	hsa-miR-216b	CLIP-seq
MIRT2537690	hsa-miR-219-5p	CLIP-seq
MIRT2537691	hsa-miR-22	CLIP-seq
MIRT2537692	hsa-miR-296-3p	CLIP-seq
MIRT2537693	hsa-miR-3119	CLIP-seq
MIRT2537694	hsa-miR-3125	CLIP-seq
MIRT2537695	hsa-miR-3130-5p	CLIP-seq
MIRT2537696	hsa-miR-3143	CLIP-seq
MIRT2537697	hsa-miR-3144-3p	CLIP-seq
MIRT1014083	hsa-miR-3155	CLIP-seq
MIRT1014084	hsa-miR-3155b	CLIP-seq
MIRT2537698	hsa-miR-3158-5p	CLIP-seq
MIRT2537699	hsa-miR-3166	CLIP-seq
MIRT2537700	hsa-miR-3173-5p	CLIP-seq
MIRT2537701	hsa-miR-3182	CLIP-seq
MIRT2537702	hsa-miR-3185	CLIP-seq
MIRT2537703	hsa-miR-3187-3p	CLIP-seq
MIRT2000359	hsa-miR-3190	CLIP-seq
MIRT2537704	hsa-miR-3192	CLIP-seq
MIRT2000360	hsa-miR-3202	CLIP-seq
MIRT2537705	hsa-miR-320a	CLIP-seq
MIRT2537706	hsa-miR-320b	CLIP-seq
MIRT2537707	hsa-miR-320c	CLIP-seq
MIRT2537708	hsa-miR-320d	CLIP-seq
MIRT2537709	hsa-miR-324-3p	CLIP-seq
MIRT2537710	hsa-miR-361-3p	CLIP-seq
MIRT2537711	hsa-miR-3620	CLIP-seq
MIRT1014085	hsa-miR-3670	CLIP-seq
MIRT2537712	hsa-miR-3673	CLIP-seq
MIRT2537713	hsa-miR-3675-3p	CLIP-seq
MIRT2000361	hsa-miR-3677-3p	CLIP-seq
MIRT2537714	hsa-miR-3689a-3p	CLIP-seq
MIRT2537715	hsa-miR-3689c	CLIP-seq
MIRT1014086	hsa-miR-3689d	CLIP-seq
MIRT2537716	hsa-miR-3692	CLIP-seq
MIRT1014077	hsa-miR-370	CLIP-seq
MIRT2537717	hsa-miR-383	CLIP-seq
MIRT1014078	hsa-miR-3911	CLIP-seq
MIRT2537718	hsa-miR-3916	CLIP-seq
MIRT2537719	hsa-miR-3943	CLIP-seq
MIRT2537720	hsa-miR-410	CLIP-seq
MIRT2537721	hsa-miR-424	CLIP-seq
MIRT2537722	hsa-miR-4252	CLIP-seq
MIRT2537723	hsa-miR-4261	CLIP-seq
MIRT2000362	hsa-miR-4270	CLIP-seq
MIRT2537724	hsa-miR-4293	CLIP-seq
MIRT2537725	hsa-miR-4313	CLIP-seq
MIRT2537726	hsa-miR-4418	CLIP-seq
MIRT2537727	hsa-miR-4425	CLIP-seq
MIRT2537728	hsa-miR-4429	CLIP-seq
MIRT2537729	hsa-miR-4436b-5p	CLIP-seq
MIRT2000363	hsa-miR-4441	CLIP-seq
MIRT2537730	hsa-miR-4453	CLIP-seq
MIRT1014087	hsa-miR-4459	CLIP-seq
MIRT2537731	hsa-miR-4480	CLIP-seq
MIRT2537732	hsa-miR-4482	CLIP-seq
MIRT2537733	hsa-miR-4490	CLIP-seq
MIRT2537734	hsa-miR-4496	CLIP-seq
MIRT2537735	hsa-miR-4524	CLIP-seq
MIRT2537736	hsa-miR-4529-5p	CLIP-seq
MIRT2000364	hsa-miR-4533	CLIP-seq
MIRT2537737	hsa-miR-4538	CLIP-seq
MIRT1014088	hsa-miR-4633-3p	CLIP-seq
MIRT2000365	hsa-miR-4642	CLIP-seq
MIRT2537738	hsa-miR-4645-3p	CLIP-seq
MIRT2537739	hsa-miR-4660	CLIP-seq
MIRT2537740	hsa-miR-4684-5p	CLIP-seq
MIRT2000366	hsa-miR-4711-5p	CLIP-seq
MIRT2537741	hsa-miR-4717-5p	CLIP-seq
MIRT2537742	hsa-miR-4719	CLIP-seq
MIRT2537743	hsa-miR-4722-5p	CLIP-seq
MIRT2537744	hsa-miR-4728-5p	CLIP-seq
MIRT2450139	hsa-miR-4743	CLIP-seq
MIRT2537745	hsa-miR-4747-5p	CLIP-seq
MIRT2537746	hsa-miR-4764-5p	CLIP-seq
MIRT2537747	hsa-miR-4768-5p	CLIP-seq
MIRT2537748	hsa-miR-4771	CLIP-seq
MIRT2537749	hsa-miR-4782-3p	CLIP-seq
MIRT2537750	hsa-miR-4793-5p	CLIP-seq
MIRT2537751	hsa-miR-4795-3p	CLIP-seq
MIRT2537752	hsa-miR-4796-5p	CLIP-seq
MIRT1014089	hsa-miR-484	CLIP-seq
MIRT2537753	hsa-miR-488	CLIP-seq
MIRT2537754	hsa-miR-494	CLIP-seq
MIRT2537755	hsa-miR-497	CLIP-seq
MIRT2537756	hsa-miR-503	CLIP-seq
MIRT2537757	hsa-miR-5047	CLIP-seq
MIRT2537758	hsa-miR-509-3-5p	CLIP-seq
MIRT2537759	hsa-miR-509-5p	CLIP-seq
MIRT2537760	hsa-miR-543	CLIP-seq
MIRT2537761	hsa-miR-544b	CLIP-seq
MIRT2537762	hsa-miR-587	CLIP-seq
MIRT2537763	hsa-miR-590-5p	CLIP-seq
MIRT2537764	hsa-miR-596	CLIP-seq
MIRT2537765	hsa-miR-642b	CLIP-seq
MIRT1014079	hsa-miR-644	CLIP-seq
MIRT2537766	hsa-miR-646	CLIP-seq
MIRT1014080	hsa-miR-663b	CLIP-seq
MIRT2537767	hsa-miR-671-5p	CLIP-seq
MIRT1014081	hsa-miR-767-3p	CLIP-seq
MIRT2537768	hsa-miR-874	CLIP-seq
MIRT1014074	hsa-miR-1178	CLIP-seq
MIRT2537672	hsa-miR-1184	CLIP-seq
MIRT2537673	hsa-miR-1205	CLIP-seq
MIRT2537677	hsa-miR-1265	CLIP-seq
MIRT2537679	hsa-miR-1286	CLIP-seq
MIRT2537680	hsa-miR-1301	CLIP-seq
MIRT2537681	hsa-miR-138	CLIP-seq
MIRT2537682	hsa-miR-146b-3p	CLIP-seq
MIRT1014075	hsa-miR-147	CLIP-seq
MIRT1014082	hsa-miR-155	CLIP-seq
MIRT2537686	hsa-miR-1913	CLIP-seq
MIRT1014076	hsa-miR-1976	CLIP-seq
MIRT2537688	hsa-miR-21	CLIP-seq
MIRT2537689	hsa-miR-216b	CLIP-seq
MIRT2537691	hsa-miR-22	CLIP-seq
MIRT2537694	hsa-miR-3125	CLIP-seq
MIRT1014083	hsa-miR-3155	CLIP-seq
MIRT1014084	hsa-miR-3155b	CLIP-seq
MIRT2537700	hsa-miR-3173-5p	CLIP-seq
MIRT2537701	hsa-miR-3182	CLIP-seq
MIRT2537702	hsa-miR-3185	CLIP-seq
MIRT2537703	hsa-miR-3187-3p	CLIP-seq
MIRT2000359	hsa-miR-3190	CLIP-seq
MIRT2537704	hsa-miR-3192	CLIP-seq
MIRT2000360	hsa-miR-3202	CLIP-seq
MIRT2537709	hsa-miR-324-3p	CLIP-seq
MIRT2537710	hsa-miR-361-3p	CLIP-seq
MIRT2537711	hsa-miR-3620	CLIP-seq
MIRT1014085	hsa-miR-3670	CLIP-seq
MIRT2000361	hsa-miR-3677-3p	CLIP-seq
MIRT2537714	hsa-miR-3689a-3p	CLIP-seq
MIRT2537715	hsa-miR-3689c	CLIP-seq
MIRT1014086	hsa-miR-3689d	CLIP-seq
MIRT1014077	hsa-miR-370	CLIP-seq
MIRT1014078	hsa-miR-3911	CLIP-seq
MIRT2537718	hsa-miR-3916	CLIP-seq
MIRT2537719	hsa-miR-3943	CLIP-seq
MIRT2537720	hsa-miR-410	CLIP-seq
MIRT2000362	hsa-miR-4270	CLIP-seq
MIRT2537725	hsa-miR-4313	CLIP-seq
MIRT2537726	hsa-miR-4418	CLIP-seq
MIRT2000363	hsa-miR-4441	CLIP-seq
MIRT1014087	hsa-miR-4459	CLIP-seq
MIRT2537733	hsa-miR-4490	CLIP-seq
MIRT2537736	hsa-miR-4529-5p	CLIP-seq
MIRT2000364	hsa-miR-4533	CLIP-seq
MIRT1014088	hsa-miR-4633-3p	CLIP-seq
MIRT2000365	hsa-miR-4642	CLIP-seq
MIRT2537739	hsa-miR-4660	CLIP-seq
MIRT2000366	hsa-miR-4711-5p	CLIP-seq
MIRT2537742	hsa-miR-4719	CLIP-seq
MIRT2537743	hsa-miR-4722-5p	CLIP-seq
MIRT2537744	hsa-miR-4728-5p	CLIP-seq
MIRT2450139	hsa-miR-4743	CLIP-seq
MIRT2537746	hsa-miR-4764-5p	CLIP-seq
MIRT1014089	hsa-miR-484	CLIP-seq
MIRT2537757	hsa-miR-5047	CLIP-seq
MIRT2537758	hsa-miR-509-3-5p	CLIP-seq
MIRT2537759	hsa-miR-509-5p	CLIP-seq
MIRT2537762	hsa-miR-587	CLIP-seq
MIRT2537763	hsa-miR-590-5p	CLIP-seq
MIRT2537765	hsa-miR-642b	CLIP-seq
MIRT1014079	hsa-miR-644	CLIP-seq
MIRT1014080	hsa-miR-663b	CLIP-seq
MIRT1014081	hsa-miR-767-3p	CLIP-seq
MIRT2537768	hsa-miR-874	CLIP-seq

Show/Hide all (58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	31091448
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0002218	Process	Activation of innate immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	26996307, 33876762
GO:0003924	Function	GTPase activity	IEA
GO:0004866	Function	Endopeptidase inhibitor activity	IDA	31091448
GO:0005515	Function	Protein binding	IPI	21151871, 22461501, 28514442, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	17266443
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	26996307, 31091448
GO:0005794	Component	Golgi apparatus	IDA	17266443, 21151871
GO:0005794	Component	Golgi apparatus	IEA
GO:0006605	Process	Protein targeting	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IMP	22461501
GO:0032741	Process	Positive regulation of interleukin-18 production	IEA
GO:0032741	Process	Positive regulation of interleukin-18 production	ISS
GO:0034067	Process	Protein localization to Golgi apparatus	IDA	21151871
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 20180847, 21151871
GO:0042803	Function	Protein homodimerization activity	IDA	21151871, 33876762
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	ISS
GO:0046718	Process	Symbiont entry into host cell	IDA	9641677
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	21151871
GO:0051289	Process	Protein homotetramerization	IDA	22461501
GO:0051604	Process	Protein maturation	IDA	31091448
GO:0051607	Process	Defense response to virus	IDA	26996307, 31091448
GO:0051715	Process	Cytolysis in another organism	IEA
GO:0051715	Process	Cytolysis in another organism	ISS
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071346	Process	Cellular response to type II interferon	IBA
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0071346	Process	Cellular response to type II interferon	IEP	17266443
GO:0098552	Component	Side of membrane	IEA
GO:0106139	Component	Symbiont cell surface	IEA
GO:0140639	Process	Positive regulation of pyroptotic inflammatory response	IEA
GO:0140639	Process	Positive regulation of pyroptotic inflammatory response	ISS
GO:0140678	Function	Molecular function inhibitor activity	IDA	31091448
GO:0140973	Process	Positive regulation of AIM2 inflammasome complex assembly	IEA
GO:0140973	Process	Positive regulation of AIM2 inflammasome complex assembly	ISS
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	ISS
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IDA	22461501

MIM	HGNC	e!Ensembl
611467	19895	ENSG00000154451

Q96PP8

Protein name

Guanylate-binding protein 5 (EC 3.6.5.-) (GBP-TA antigen) (GTP-binding protein 5) (GBP-5) (Guanine nucleotide-binding protein 5)

Protein function

Interferon (IFN)-inducible GTPase that plays important roles in innate immunity against a diverse range of bacterial, viral and protozoan pathogens (By similarity). Hydrolyzes GTP, but in contrast to other family members, does not produce GMP (P

PDB

7CKF , 7E59 , 7E5A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02263	GBP	18 → 280	Guanylate-binding protein, N-terminal domain	Domain
PF02841	GBP_C	282 → 574	Guanylate-binding protein, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in peripheral blood monocytes (at protein level). {ECO:0000269|PubMed:15175044}.

Sequence

MALEIHMSDPMCLIENFNEQLKVNQEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KNKGFSVASTVQSHTKGIWIWCVPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQIFALAL
LLSSTFVYNTVNKIDQGAIDLLHNVTELTDLLKARNSPDLDRVEDPADSASFFPDLVWTL
RDFCLGLEIDGQLVTPDEYLENSLRPKQGSDQRVQNFNLPRLCIQKFFPKKKCFIFDLPA
HQKKLAQLETLPDDELEPEFVQQVTEFCSYIFSHSMTKTLPGGIMVNGSRLKNLVLTYVN
AISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKVQLPMETLQELLDLHRTSER
EAIEVFMKNSFKDVDQSFQKELETLLDAKQNDICKRNLEASSDYCSALLKDIFGPLEEAV
KQGIYSKPGGHNLFIQKTEELKAKYYREPRKGIQAEEVLQKYLKSKESVSHAILQTDQAL
TETEKKKKEAQVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQ
QKMQEQQMQEQAAQLSTTFQAQNRSLLSELQHAQRTVNNDDPCVLL

Sequence length

586

Interactions

View interactions

	KEGG		Reactome
	NOD-like receptor signaling pathway		Interferon gamma signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	29489025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	30408130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	30408130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33897701, 35637633, 37551111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	26965581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	CTD_human_DG	30097691		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	30097691	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35213358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	30097691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26025597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38136991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20180847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15175044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	32639949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	31600201	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29381915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15175044, 29489025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35163645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32702921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	29489025		★★★★★ ★☆☆☆☆ Found in Text Mining only

GBP5 (guanylate binding protein 5)