FCRL3 (Fc receptor like 3)

Gene

• Entrez ID: 115352
• Gene name: Fc receptor like 3
• Gene symbol: FCRL3
• Synonyms (NCBI Gene): CD307c, FCRH3, IFGP3, IRTA3, MAIA, SPAP2
• Chromosome: 1
• Chromosome location: 1q23.1
• Summary: This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT994140	hsa-miR-1270	CLIP-seq
MIRT994141	hsa-miR-1273g	CLIP-seq
MIRT994142	hsa-miR-185	CLIP-seq
MIRT994143	hsa-miR-3925-5p	CLIP-seq
MIRT994144	hsa-miR-4306	CLIP-seq
MIRT994145	hsa-miR-4531	CLIP-seq
MIRT994146	hsa-miR-4644	CLIP-seq
MIRT994147	hsa-miR-4773	CLIP-seq
MIRT994148	hsa-miR-522	CLIP-seq
MIRT994149	hsa-miR-620	CLIP-seq
MIRT1994800	hsa-miR-1178	CLIP-seq
MIRT1994801	hsa-miR-1343	CLIP-seq
MIRT1994802	hsa-miR-2110	CLIP-seq
MIRT1994803	hsa-miR-3166	CLIP-seq
MIRT1994804	hsa-miR-4269	CLIP-seq
MIRT1994805	hsa-miR-4271	CLIP-seq
MIRT1994806	hsa-miR-4514	CLIP-seq
MIRT1994807	hsa-miR-4667-5p	CLIP-seq
MIRT1994808	hsa-miR-4692	CLIP-seq
MIRT1994809	hsa-miR-4700-5p	CLIP-seq
MIRT1994810	hsa-miR-4725-3p	CLIP-seq
MIRT1994811	hsa-miR-4742-5p	CLIP-seq
MIRT1994812	hsa-miR-4771	CLIP-seq
MIRT1994813	hsa-miR-4772-5p	CLIP-seq
MIRT2228939	hsa-miR-4789-5p	CLIP-seq
MIRT2449602	hsa-miR-4273	CLIP-seq
MIRT2449603	hsa-miR-4677-5p	CLIP-seq
MIRT2449604	hsa-miR-578	CLIP-seq
MIRT2449602	hsa-miR-4273	CLIP-seq
MIRT2449603	hsa-miR-4677-5p	CLIP-seq
MIRT2449604	hsa-miR-578	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002638	Process	Negative regulation of immunoglobulin production	IDA	23857366
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	12051764, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0006955	Process	Immune response	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007338	Process	Single fertilization	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	16849395
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0019900	Function	Kinase binding	IPI	19843936
GO:0019902	Function	Phosphatase binding	IEA
GO:0019902	Function	Phosphatase binding	IPI	19843936
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	23857366
GO:0031528	Component	Microvillus membrane	IEA
GO:0034163	Process	Regulation of toll-like receptor 9 signaling pathway	IDA	23857366
GO:0042995	Component	Cell projection	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	23857366
GO:0045577	Process	Regulation of B cell differentiation	IDA	23857366
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IDA	19843936
GO:0050864	Process	Regulation of B cell activation	IDA	23857366
GO:0090279	Process	Regulation of calcium ion import	IDA	19843936

Other IDs

• MIM: 606510
• HGNC: 18506
• e!Ensembl: ENSG00000160856

Protein

• UniProt ID: Q96P31
• Protein name: Fc receptor-like protein 3 (FcR-like protein 3) (FcRL3) (Fc receptor homolog 3) (FcRH3) (IFGP family protein 3) (hIFGP3) (Immune receptor translocation-associated protein 3) (MAIA) (SH2 domain-containing phosphatase anchor protein 2) (CD antigen CD307c)
• Protein function: Promotes TLR9-induced B-cell proliferation, activation and survival but inhibits antibody production and suppresses plasma cell differentiation. Enhances activation of NF-kappa-B and MAPK signaling pathways in TLR9 stimulated B-cells (PubMed:238
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	101 → 185	Immunoglobulin domain	Domain
  PF13895	Ig_2	191 → 280	Immunoglobulin domain	Domain
  PF00047	ig	292 → 370	Immunoglobulin domain	Domain
  PF13895	Ig_2	382 → 471	Immunoglobulin domain	Domain
  PF13895	Ig_2	475 → 562	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Low expression on transitional B cells which increases to higher surface expression on mature and memory B-cells with innate-like features (at protein leve
• Sequence:

  MLLWLLLLILTPGREQSGVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYH
  DEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRC
  QGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKP
  LNIQVQELFLHPVLRASSSTPIEGSPMTLTCETQLSPQRPDVQLQFSLFRDSQTLGLGWS
  RSPRLQIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRVQRVPVSNVNLEIRPTGGQLI
  EGENMVLICSVAQGSGTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKESDAGRYYCAA
  DNVHSPILSTWIRVTVRIPVSHPVLTFRAPRAHTVVGDLLELHCESLRGSPPILYRFYHE
  DVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSHGVSLRVTVPVSRPVLTL
  RAPGAQAVVGDLLELHCESLRGSFPILYWFYHEDDTLGNISAHSGGGASFNLSLTTEHSG
  NYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGITGLVLSILVLAAAAALLHYARAR
  RKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNP
  IYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEE
  NYENVPRVLLASDH

• Sequence length: 734

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELECTIVE IGA DEFICIENCY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROIDITIS, AUTOIMMUNE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	26350270		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	18341485		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	25594855, 30771554		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	17117947		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	17117947		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	LHGDN	17117947		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	19657722		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15838509, 16176992, 16859508, 17133579, 17179172, 20190142, 22392608, 29193869	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23070121, 30771554		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31945409	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	17020818		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	LHGDN	17020818		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15838509, 16384851, 17020818, 17117947, 17200162, 17389014, 17462505, 17617473, 17868046, 17961971, 18065500, 18556175, 19050767, 19235910, 19343617, 19452015, 19843936, 20626413, 21299530, 22458979, 24117236, 24593204, 25594855, 26334889, 26350270, 31341856		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	17868046, 19050767, 19452015, 20190142, 20626413, 25594855, 26334889, 32023449	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	CTD_human_DG	17952073		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	29890552		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	18704934		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	19050767, 31341856		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	19050767		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	19050767, 37264476	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28059167	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18704934, 20923685		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	18704934		★☆☆☆☆ Found in Text Mining only
Congenital myasthenic syndrome with episodic apnea	Congenital myasthenic syndrome	Pubtator	25829454	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17389014, 19235910		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	26402798		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	26402798	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17200162, 17961971, 27615679		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	21529967, 21663782, 22341374, 23553198, 26334889		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22341374, 23553198, 26334889	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	16384851, 17200162, 19438904, 20626413, 22706687, 23505439, 26321232, 27863461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	GWASCAT_DG	21841780		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	CTD_human_DG	21841780		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	GWASDB_DG	21841780		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	23505439, 27863461	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	22458979		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	22706687, 29890552		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24504816	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	31433201, 31780315		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune System Diseases	BEFREE	23070121		★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	GWASCAT_DG	27723758		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	22341374, 23553198	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17389014		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17389014		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	17389014		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	18065500		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	21078711		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15838509, 17133581, 38461541	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17117947, 17133581, 17200162, 17462505, 18556175, 19565352, 19690864, 21078711, 23070121, 23512175, 24593204		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17133581		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	23792457		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27766406		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17617473, 18313765, 25862376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	26402798, 33037294, 36759259	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	26920376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	36864689	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	23792457		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	25575677, 26402798		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31945409	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	21299530		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15838509, 16176992, 16476711, 16859508, 17133579, 17133581, 17179172, 17200162, 17462505, 17932559, 17961971, 18065500, 18087673, 19324521, 19657722, 19690864, 20732364, 21078711, 21885492, 22386693, 22392608, 23463945, 23777926, 23883198, 26350270, 26746625		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17133579, 17133581, 17763442, 17961971, 18087673		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	24532676		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	25594855	Associate	★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	GWASCAT_DG	27723758		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	23792457, 30638415		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	23792457, 30638415	Associate	★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	30021560		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	17133581		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	15838509, 17133579, 17133581, 17952073, 37197658	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17389014		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	19452015		★☆☆☆☆ Found in Text Mining only