Gene Gene information from NCBI Gene database.
Entrez ID 115350
Gene name Fc receptor like 1
Gene symbol FCRL1
Synonyms (NCBI Gene)
CD307aFCRH1IFGP1IRTA5
Chromosome 1
Chromosome location 1q23.1
Summary This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains three extracellular C2-like immunoglobulin domains, a transm
miRNA miRNA information provided by mirtarbase database.
81
miRTarBase ID miRNA Experiments Reference
MIRT994071 hsa-miR-1261 CLIP-seq
MIRT994072 hsa-miR-1269 CLIP-seq
MIRT994073 hsa-miR-1269b CLIP-seq
MIRT994074 hsa-miR-1278 CLIP-seq
MIRT994075 hsa-miR-1285 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0005886 Component Plasma membrane IEA
GO:0006955 Process Immune response IBA
GO:0007166 Process Cell surface receptor signaling pathway IBA
GO:0009897 Component External side of plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606508 18509 ENSG00000163534
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96LA6
Protein name Fc receptor-like protein 1 (FcR-like protein 1) (FcRL1) (Fc receptor homolog 1) (FcRH1) (IFGP family protein 1) (hIFGP1) (Immune receptor translocation-associated protein 5) (CD antigen CD307a)
Protein function Type I transmembrane surface glycoprotein preferentially expressed by B-cells that regulates BCR-mediated signaling responses (PubMed:15479727). Recruits ABL1 as the intracellular effector molecule to enhance B-cell activation (By similarity). A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 18 105 Immunoglobulin domain Domain
PF13927 Ig_3 113 187 Domain
PF17736 Ig_C17orf99 217 296 C17orf99 Ig domain Domain
Tissue specificity TISSUE SPECIFICITY: Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression
Sequence
MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRA
LGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINV
HRVPVADVSLETQPP
GGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQ
YYCVAEN
GYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILY
WFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTV
PTGA
RSNHLTSGVIEGLLSTLGPATVALLFCYGLKRKIGRRSARDPLRSLPSPLPQEFTYLNSP
TPGQLQPIYENVNVVSGDEVYSLAYYNQPEQESVAAETLGTHMEDKVSLDIYSRLRKANI
TDVDYEDAM
Sequence length 429
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MULTIPLE SCLEROSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 18802695
★☆☆☆☆
Found in Text Mining only
Ataxia Telangiectasia Ataxia telangiectasia Pubtator 32366930 Associate
★☆☆☆☆
Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE Lymphocytic Leukemia BEFREE 18704934
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 37684436 Inhibit
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 23950870 Associate
★☆☆☆☆
Found in Text Mining only
Chronic Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 18704934, 29476700
★☆☆☆☆
Found in Text Mining only
Chronic Lymphocytic Leukemia Lymphocytic Leukemia LHGDN 18704934
★☆☆☆☆
Found in Text Mining only
Dystonic Disorders Dystonia Pubtator 31640787 Associate
★☆☆☆☆
Found in Text Mining only
Graves Disease Graves Disease GWASDB_DG 21841780
★☆☆☆☆
Found in Text Mining only
Graves Disease Graves Disease BEFREE 25738996
★☆☆☆☆
Found in Text Mining only