Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	115350
Gene name	Fc receptor like 1
Gene symbol	FCRL1
Synonyms (NCBI Gene)	CD307aFCRH1IFGP1IRTA5
Chromosome	1
Chromosome location	1q23.1
Summary	This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains three extracellular C2-like immunoglobulin domains, a transm

Show/Hide all (81)

miRTarBase ID	miRNA	Experiments
MIRT994071	hsa-miR-1261	CLIP-seq
MIRT994072	hsa-miR-1269	CLIP-seq
MIRT994073	hsa-miR-1269b	CLIP-seq
MIRT994074	hsa-miR-1278	CLIP-seq
MIRT994075	hsa-miR-1285	CLIP-seq
MIRT994076	hsa-miR-1288	CLIP-seq
MIRT994077	hsa-miR-155	CLIP-seq
MIRT994078	hsa-miR-190	CLIP-seq
MIRT994079	hsa-miR-190b	CLIP-seq
MIRT994080	hsa-miR-1912	CLIP-seq
MIRT994081	hsa-miR-219-2-3p	CLIP-seq
MIRT994082	hsa-miR-2964a-3p	CLIP-seq
MIRT994083	hsa-miR-3130-5p	CLIP-seq
MIRT994084	hsa-miR-3187-5p	CLIP-seq
MIRT994085	hsa-miR-3201	CLIP-seq
MIRT994086	hsa-miR-3614-5p	CLIP-seq
MIRT994087	hsa-miR-3622b-5p	CLIP-seq
MIRT994088	hsa-miR-365	CLIP-seq
MIRT994089	hsa-miR-3662	CLIP-seq
MIRT994090	hsa-miR-3672	CLIP-seq
MIRT994091	hsa-miR-3926	CLIP-seq
MIRT994092	hsa-miR-3976	CLIP-seq
MIRT994093	hsa-miR-4252	CLIP-seq
MIRT994094	hsa-miR-432	CLIP-seq
MIRT994095	hsa-miR-4480	CLIP-seq
MIRT994096	hsa-miR-4482	CLIP-seq
MIRT994097	hsa-miR-4515	CLIP-seq
MIRT994098	hsa-miR-4529-3p	CLIP-seq
MIRT994099	hsa-miR-4680-3p	CLIP-seq
MIRT994100	hsa-miR-4740-5p	CLIP-seq
MIRT994101	hsa-miR-4786-5p	CLIP-seq
MIRT994102	hsa-miR-4791	CLIP-seq
MIRT994103	hsa-miR-522	CLIP-seq
MIRT994104	hsa-miR-548c-3p	CLIP-seq
MIRT994105	hsa-miR-548s	CLIP-seq
MIRT994106	hsa-miR-553	CLIP-seq
MIRT994107	hsa-miR-612	CLIP-seq
MIRT994108	hsa-miR-654-3p	CLIP-seq
MIRT994109	hsa-miR-661	CLIP-seq
MIRT994110	hsa-miR-769-5p	CLIP-seq
MIRT994111	hsa-miR-890	CLIP-seq
MIRT994077	hsa-miR-155	CLIP-seq
MIRT994081	hsa-miR-219-2-3p	CLIP-seq
MIRT994082	hsa-miR-2964a-3p	CLIP-seq
MIRT994088	hsa-miR-365	CLIP-seq
MIRT994093	hsa-miR-4252	CLIP-seq
MIRT994099	hsa-miR-4680-3p	CLIP-seq
MIRT1994785	hsa-miR-380	CLIP-seq
MIRT1994786	hsa-miR-3924	CLIP-seq
MIRT1994787	hsa-miR-4495	CLIP-seq
MIRT994101	hsa-miR-4786-5p	CLIP-seq
MIRT994104	hsa-miR-548c-3p	CLIP-seq
MIRT994110	hsa-miR-769-5p	CLIP-seq
MIRT2228932	hsa-miR-1208	CLIP-seq
MIRT994074	hsa-miR-1278	CLIP-seq
MIRT2228933	hsa-miR-1470	CLIP-seq
MIRT994077	hsa-miR-155	CLIP-seq
MIRT994081	hsa-miR-219-2-3p	CLIP-seq
MIRT994082	hsa-miR-2964a-3p	CLIP-seq
MIRT994088	hsa-miR-365	CLIP-seq
MIRT994093	hsa-miR-4252	CLIP-seq
MIRT2228934	hsa-miR-4420	CLIP-seq
MIRT2228935	hsa-miR-4667-3p	CLIP-seq
MIRT994099	hsa-miR-4680-3p	CLIP-seq
MIRT994103	hsa-miR-522	CLIP-seq
MIRT994104	hsa-miR-548c-3p	CLIP-seq
MIRT2680924	hsa-miR-2114	CLIP-seq
MIRT2680925	hsa-miR-214	CLIP-seq
MIRT2680926	hsa-miR-3619-5p	CLIP-seq
MIRT994087	hsa-miR-3622b-5p	CLIP-seq
MIRT2680927	hsa-miR-3929	CLIP-seq
MIRT2680928	hsa-miR-4291	CLIP-seq
MIRT2680929	hsa-miR-4419b	CLIP-seq
MIRT2680930	hsa-miR-4478	CLIP-seq
MIRT2680931	hsa-miR-455-5p	CLIP-seq
MIRT2680932	hsa-miR-4690-5p	CLIP-seq
MIRT2680933	hsa-miR-510	CLIP-seq
MIRT2680934	hsa-miR-512-5p	CLIP-seq
MIRT2680935	hsa-miR-550a	CLIP-seq
MIRT2680936	hsa-miR-761	CLIP-seq
MIRT2680937	hsa-miR-922	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006955	Process	Immune response	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	16849395
GO:0009986	Component	Cell surface	IEA
GO:0015026	Function	Coreceptor activity	IDA	15479727
GO:0016020	Component	Membrane	IEA
GO:0042113	Process	B cell activation	IDA	15479727

MIM	HGNC	e!Ensembl
606508	18509	ENSG00000163534

Q96LA6

Protein name

Fc receptor-like protein 1 (FcR-like protein 1) (FcRL1) (Fc receptor homolog 1) (FcRH1) (IFGP family protein 1) (hIFGP1) (Immune receptor translocation-associated protein 5) (CD antigen CD307a)

Protein function

Type I transmembrane surface glycoprotein preferentially expressed by B-cells that regulates BCR-mediated signaling responses (PubMed:15479727). Recruits ABL1 as the intracellular effector molecule to enhance B-cell activation (By similarity). A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	18 → 105	Immunoglobulin domain	Domain
PF13927	Ig_3	113 → 187		Domain
PF17736	Ig_C17orf99	217 → 296	C17orf99 Ig domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression

Sequence

MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRA
LGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPP
GGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQ
YYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILY
WFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGA
RSNHLTSGVIEGLLSTLGPATVALLFCYGLKRKIGRRSARDPLRSLPSPLPQEFTYLNSP
TPGQLQPIYENVNVVSGDEVYSLAYYNQPEQESVAAETLGTHMEDKVSLDIYSRLRKANI
TDVDYEDAM

Sequence length

429

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18802695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	32366930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	18704934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37684436	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23950870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18704934, 29476700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	18704934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Dystonia	Pubtator	31640787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	GWASDB_DG	21841780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	25738996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	25738996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24504816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23950870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29476700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29476700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	29476700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22411186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	24076602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	23950870, 29476700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	18802695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	25738996		★★★★★ ★☆☆☆☆ Found in Text Mining only

FCRL1 (Fc receptor like 1)