Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	115265
Gene name	DNA damage inducible transcript 4 like
Gene symbol	DDIT4L
Synonyms (NCBI Gene)	REDD2Rtp801L
Chromosome	4
Chromosome location	4q24

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments
MIRT929358	hsa-miR-105	CLIP-seq
MIRT929359	hsa-miR-141	CLIP-seq
MIRT929360	hsa-miR-200a	CLIP-seq
MIRT929361	hsa-miR-3190	CLIP-seq
MIRT929362	hsa-miR-33a	CLIP-seq
MIRT929363	hsa-miR-33b	CLIP-seq
MIRT929364	hsa-miR-4277	CLIP-seq
MIRT929365	hsa-miR-4495	CLIP-seq
MIRT929366	hsa-miR-450b-5p	CLIP-seq
MIRT929367	hsa-miR-4735-5p	CLIP-seq
MIRT929368	hsa-miR-4752	CLIP-seq
MIRT929369	hsa-miR-4766-5p	CLIP-seq
MIRT929370	hsa-miR-4794	CLIP-seq
MIRT929371	hsa-miR-507	CLIP-seq
MIRT929372	hsa-miR-548a-3p	CLIP-seq
MIRT929373	hsa-miR-548e	CLIP-seq
MIRT929374	hsa-miR-548f	CLIP-seq
MIRT929375	hsa-miR-557	CLIP-seq
MIRT929376	hsa-miR-570	CLIP-seq
MIRT929377	hsa-miR-600	CLIP-seq
MIRT929378	hsa-miR-892b	CLIP-seq
MIRT2210571	hsa-miR-549	CLIP-seq

Show/Hide all (4)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 27107012, 31515488, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0009968	Process	Negative regulation of signal transduction	IEA

MIM	HGNC	e!Ensembl
607730	30555	ENSG00000145358

Q96D03

Protein name

DNA damage-inducible transcript 4-like protein (HIF-1 responsive protein RTP801-like) (Protein regulated in development and DNA damage response 2) (REDD-2)

Protein function

Inhibits cell growth by regulating the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07809	RTP801_C	65 → 183	RTP801 C-terminal region	Family

Tissue specificity

TISSUE SPECIFICITY: Up-regulated in atherosclerotic plaques relative to healthy segments of the same artery. {ECO:0000269|PubMed:15308555}.

Sequence

MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKM
LENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKK
LDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKK
LYSLIGTTVIEGS

Sequence length

193

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atrial Fibrillation	Atrial fibrillation	Pubtator	33062700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	38003044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	16778180		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	38218802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	38218802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DDIT4L (DNA damage inducible transcript 4 like)