CKB (creatine kinase B)

Gene

• Entrez ID: 1152
• Gene name: Creatine kinase B
• Gene symbol: CKB
• Synonyms (NCBI Gene): B-CK, BCK, CKBB, CPK-B, HEL-211, HEL-S-29
• Chromosome: 14
• Chromosome location: 14q32.33
• Summary: The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052190	hsa-let-7b-5p	CLASH	23622248
MIRT049124	hsa-miR-92a-3p	CLASH	23622248
MIRT044642	hsa-miR-320a	CLASH	23622248
MIRT043074	hsa-miR-324-5p	CLASH	23622248
MIRT042718	hsa-miR-346	CLASH	23622248
MIRT042674	hsa-miR-196b-5p	CLASH	23622248
MIRT037448	hsa-miR-744-5p	CLASH	23622248
MIRT037448	hsa-miR-744-5p	CLASH	23622248
MIRT036653	hsa-miR-935	CLASH	23622248
MIRT036653	hsa-miR-935	CLASH	23622248
MIRT052723	hsa-miR-1260b	CLASH	23622248
MIRT736752	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR	25601461
MIRT731201	hsa-miR-551a	Luciferase reporter assay, qRT-PCR	25601461
MIRT731201	hsa-miR-551a	Luciferase reporter assay, qRT-PCR	25601461
MIRT735898	hsa-miR-483-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31792031
MIRT736752	hsa-miR-483-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	25601461
MIRT731201	hsa-miR-551a	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	25601461
MIRT894208	hsa-miR-214	CLIP-seq
MIRT894209	hsa-miR-3619-5p	CLIP-seq
MIRT894210	hsa-miR-4291	CLIP-seq
MIRT894211	hsa-miR-4310	CLIP-seq
MIRT894212	hsa-miR-4645-5p	CLIP-seq
MIRT894213	hsa-miR-4662a-5p	CLIP-seq
MIRT894214	hsa-miR-4673	CLIP-seq
MIRT894215	hsa-miR-4711-5p	CLIP-seq
MIRT894216	hsa-miR-4742-5p	CLIP-seq
MIRT894217	hsa-miR-541	CLIP-seq
MIRT894218	hsa-miR-654-5p	CLIP-seq
MIRT894219	hsa-miR-761	CLIP-seq
MIRT894220	hsa-miR-922	CLIP-seq
MIRT1965138	hsa-miR-139-5p	CLIP-seq
MIRT894208	hsa-miR-214	CLIP-seq
MIRT1965139	hsa-miR-3120-3p	CLIP-seq
MIRT1965140	hsa-miR-342-5p	CLIP-seq
MIRT894209	hsa-miR-3619-5p	CLIP-seq
MIRT894210	hsa-miR-4291	CLIP-seq
MIRT894211	hsa-miR-4310	CLIP-seq
MIRT894213	hsa-miR-4662a-5p	CLIP-seq
MIRT1965141	hsa-miR-4664-5p	CLIP-seq
MIRT1965142	hsa-miR-4684-5p	CLIP-seq
MIRT894215	hsa-miR-4711-5p	CLIP-seq
MIRT894219	hsa-miR-761	CLIP-seq
MIRT894220	hsa-miR-922	CLIP-seq
MIRT1965140	hsa-miR-342-5p	CLIP-seq
MIRT1965141	hsa-miR-4664-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004111	Function	Creatine kinase activity	IBA
GO:0004111	Function	Creatine kinase activity	IDA	8186255
GO:0004111	Function	Creatine kinase activity	IEA
GO:0004111	Function	Creatine kinase activity	ISS
GO:0004111	Function	Creatine kinase activity	TAS	3034271
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 19264780, 21145461, 25416956, 28514442, 32296183, 33961781, 35271311, 37207277
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016772	Function	Transferase activity, transferring phosphorus-containing groups	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19725078
GO:0046314	Process	Phosphocreatine biosynthetic process	IBA
GO:0046314	Process	Phosphocreatine biosynthetic process	IDA	8186255
GO:0046314	Process	Phosphocreatine biosynthetic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	11487543, 19056867, 23533145
GO:0140651	Process	Futile creatine cycle	IEA

Other IDs

• MIM: 123280
• HGNC: 1991
• e!Ensembl: ENSG00000166165

Protein

• UniProt ID: P12277
• Protein name: Creatine kinase B-type (EC 2.7.3.2) (Brain creatine kinase) (B-CK) (Creatine kinase B chain) (Creatine phosphokinase B-type) (CPK-B)
• Protein function: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate) (PubMed:8186255). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demand
• PDB: 3B6R, 3DRB, 3DRE, 6V9H, 7BF1, 7TUN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02807	ATP-gua_PtransN	24 → 94	ATP:guanido phosphotransferase, N-terminal domain	Domain
  PF00217	ATP-gua_Ptrans	153 → 367	ATP:guanido phosphotransferase, C-terminal catalytic domain	Domain

• Sequence:

  MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTG
  VDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD
  LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
  EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
  QKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
  NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
  IEMEQRLEQGQAIDDLMPAQK

• Sequence length: 381

Pathways

KEGG:

Arginine and proline metabolism
Metabolic pathways

Reactome:

Creatine metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian insufficiency	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	15966572		★☆☆☆☆ Found in Text Mining only
Acute schizophrenia	Schizophrenia	PSYGENET_DG	22623148		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	6948128		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10820214	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15375609		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	3733865	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27149373	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	30358701	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22500095	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15589584, 23416112		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11804344		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11804344		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21308735		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	16424007		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16424007		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21308735	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	12531894	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27665439		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37396184	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15589584		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10340745, 8926040		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10340745, 8926040		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	15996648		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	39684755	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21403395, 22627493, 23416527		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	23416112		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23269812	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	36750132	Stimulate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	CTD_human_DG	11406506		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	15996648		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	10820214	Inhibit	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	32209064	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15375609		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15589584, 23416112		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15378696		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26460485		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15589584, 23416112		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11804344		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21308735		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	12359538		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	23416112, 25601461		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	10820214	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	3508049		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15589584, 23416112		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	9270056		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36750132	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	40640242	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	22623148		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22623148		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	CTD_human_DG	2828370		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	2883200		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	2438285, 28448532, 2883200	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26460485		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15378696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	BEFREE	26460485		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	26460485	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	LHGDN	18552983		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	24183353	Associate	★☆☆☆☆ Found in Text Mining only