Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	115111
Gene name	Solute carrier family 26 member 7
Gene symbol	SLC26A7
Synonyms (NCBI Gene)	SUT2
Chromosome	8
Chromosome location	8q21.3
Summary	This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in gene structure and protein length yet have markedly different tissue expression patterns. This gene has abundant and specific expression in the ki

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs774517670	C>T	Likely-pathogenic	Stop gained, coding sequence variant

Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018335	hsa-miR-335-5p	Microarray	18185580
MIRT023903	hsa-miR-1-3p	Microarray	18668037
MIRT653673	hsa-miR-409-3p	HITS-CLIP	23824327
MIRT653672	hsa-miR-3156-5p	HITS-CLIP	23824327
MIRT653671	hsa-miR-33a-3p	HITS-CLIP	23824327
MIRT653670	hsa-miR-4307	HITS-CLIP	23824327
MIRT653669	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT653668	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT653667	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT653666	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT653665	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT653673	hsa-miR-409-3p	HITS-CLIP	23824327
MIRT653672	hsa-miR-3156-5p	HITS-CLIP	23824327
MIRT653671	hsa-miR-33a-3p	HITS-CLIP	23824327
MIRT653670	hsa-miR-4307	HITS-CLIP	23824327
MIRT653669	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT653668	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT653667	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT653666	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT653665	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT1357932	hsa-miR-103a	CLIP-seq
MIRT1357933	hsa-miR-107	CLIP-seq
MIRT1357934	hsa-miR-1184	CLIP-seq
MIRT1357935	hsa-miR-1202	CLIP-seq
MIRT1357936	hsa-miR-151-3p	CLIP-seq
MIRT1357937	hsa-miR-19a	CLIP-seq
MIRT1357938	hsa-miR-19b	CLIP-seq
MIRT1357939	hsa-miR-3124-3p	CLIP-seq
MIRT1357940	hsa-miR-3194-5p	CLIP-seq
MIRT1357941	hsa-miR-338-3p	CLIP-seq
MIRT1357942	hsa-miR-34b	CLIP-seq
MIRT1357943	hsa-miR-3662	CLIP-seq
MIRT1357944	hsa-miR-3972	CLIP-seq
MIRT1357945	hsa-miR-4330	CLIP-seq
MIRT1357946	hsa-miR-4418	CLIP-seq
MIRT1357947	hsa-miR-4698	CLIP-seq
MIRT1357948	hsa-miR-4699-5p	CLIP-seq
MIRT1357949	hsa-miR-4709-3p	CLIP-seq
MIRT1357950	hsa-miR-4720-3p	CLIP-seq
MIRT1357951	hsa-miR-4757-5p	CLIP-seq
MIRT1357952	hsa-miR-4764-3p	CLIP-seq
MIRT1357953	hsa-miR-4775	CLIP-seq
MIRT1357954	hsa-miR-4804-3p	CLIP-seq
MIRT1357955	hsa-miR-491-3p	CLIP-seq
MIRT1357956	hsa-miR-509-3-5p	CLIP-seq
MIRT1357957	hsa-miR-509-5p	CLIP-seq
MIRT1357958	hsa-miR-541	CLIP-seq
MIRT1357959	hsa-miR-629	CLIP-seq
MIRT1357960	hsa-miR-640	CLIP-seq
MIRT1357961	hsa-miR-654-5p	CLIP-seq
MIRT1357947	hsa-miR-4698	CLIP-seq
MIRT2330365	hsa-miR-4318	CLIP-seq
MIRT2330366	hsa-miR-4693-5p	CLIP-seq
MIRT2330367	hsa-miR-550b	CLIP-seq
MIRT2330368	hsa-miR-892a	CLIP-seq
MIRT2459634	hsa-miR-3148	CLIP-seq
MIRT2459635	hsa-miR-4276	CLIP-seq
MIRT2459636	hsa-miR-570	CLIP-seq
MIRT1357941	hsa-miR-338-3p	CLIP-seq
MIRT2691033	hsa-miR-4530	CLIP-seq
MIRT2691034	hsa-miR-4672	CLIP-seq

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001696	Process	Gastric acid secretion	IEA
GO:0005253	Function	Monoatomic anion channel activity	IEA
GO:0005254	Function	Chloride channel activity	IDA	11834742
GO:0005254	Function	Chloride channel activity	IEA
GO:0005254	Function	Chloride channel activity	TAS
GO:0005737	Component	Cytoplasm	IDA	16524946
GO:0005768	Component	Endosome	IDA	16524946
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006590	Process	Thyroid hormone generation	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006820	Process	Monoatomic anion transport	IEA
GO:0006821	Process	Chloride transport	IDA	11834742
GO:0006821	Process	Chloride transport	IEA
GO:0015106	Function	Bicarbonate transmembrane transporter activity	IEA
GO:0015106	Function	Bicarbonate transmembrane transporter activity	ISS	12736153
GO:0015116	Function	Sulfate transmembrane transporter activity	IBA
GO:0015116	Function	Sulfate transmembrane transporter activity	IDA	11834742
GO:0015297	Function	Antiporter activity	IEA
GO:0015701	Process	Bicarbonate transport	IEA
GO:0015701	Process	Bicarbonate transport	ISS	12736153
GO:0015705	Process	Iodide transport	IEA
GO:0015705	Process	Iodide transport	IMP	31372509
GO:0015706	Process	Nitrate transmembrane transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	30333321, 32119864
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IMP	16524946
GO:0016324	Component	Apical plasma membrane	IDA	31372509
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IDA	31372509
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0019531	Function	Oxalate transmembrane transporter activity	IBA
GO:0019531	Function	Oxalate transmembrane transporter activity	IDA	11834742
GO:0019532	Process	Oxalate transport	IBA
GO:0019532	Process	Oxalate transport	IDA	11834742
GO:0019532	Process	Oxalate transport	IEA
GO:0035429	Process	Gluconate transmembrane transport	IEA
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0140900	Function	Chloride:bicarbonate antiporter activity	IBA
GO:0140900	Function	Chloride:bicarbonate antiporter activity	IDA	12736153, 32119864
GO:0140900	Function	Chloride:bicarbonate antiporter activity	IEA
GO:1902358	Process	Sulfate transmembrane transport	IBA
GO:1902358	Process	Sulfate transmembrane transport	IDA	11834742
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	IBA
GO:1905039	Process	Carboxylic acid transmembrane transport	IEA

MIM	HGNC	e!Ensembl
608479	14467	ENSG00000147606

Q8TE54

Protein name

Anion exchange transporter (Solute carrier family 26 member 7)

Protein function

Acts as an anion channel mediating the transport of chloride, sulfate and oxalate ions (PubMed:11834742). Mediates the transport of bromide, iodide, nitrate, gluconate, thiocyanate and bicarbonate ions (By similarity). Its permeability towards b

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00916	Sulfate_transp	47 → 444	Sulfate permease family	Family
PF01740	STAS	493 → 637	STAS domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the thyroid gland (at protein level). Expressed in tonsillar high endothelial venule endothelial cells (HEVEC), placenta and in testis, expressed in a subgroup of basal cells in the epididymal ducts. {ECO:0000269|PubMed:11

Sequence

MTGAKRKKKSMLWSKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGHHVATGTFALTSLISANAVERIVP
QNMQNLTTQSNTSVLGLSDFEMQRIHVAAAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTVSI
KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDI
SKCEQNTLLNSLSNGNCNEEASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGR
SVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV

Sequence length

656

Interactions

View interactions

	KEGG		Reactome
	Gastric acid secretion		Multifunctional anion exchangers

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Congenital hypothyroidism	Likely pathogenic	rs774517670	RCV001028069	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Hyperoxaluria	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC26A7-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	10192399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34516545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34944008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	29546359, 30333321		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital Hypothyroidism	Congenital hypothyroidism	Pubtator	34200080	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Diarrhea	Diarrhea	Pubtator	34270794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic Dysplasia	BEFREE	10192399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal Renal Tubular Acidosis	Distal Renal Tubular Acidosis	BEFREE	19723628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	BEFREE	1289181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	34270794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	21822266		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tauopathies	Tauopathies	BEFREE	21355046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36465624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	27796151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC26A7 (solute carrier family 26 member 7)