Gene Gene information from NCBI Gene database.
Entrez ID 115106
Gene name HAUS augmin like complex subunit 1
Gene symbol HAUS1
Synonyms (NCBI Gene)
CCDC5HEI-CHEICHsT1461
Chromosome 18
Chromosome location 18q21.1
Summary HAUS1 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb `augmentare,` meaning `to increase.` The augmin complex is a microtubule-binding co
miRNA miRNA information provided by mirtarbase database.
9
miRTarBase ID miRNA Experiments Reference
MIRT049760 hsa-miR-92a-3p CLASH 23622248
MIRT1040993 hsa-miR-3125 CLIP-seq
MIRT1040994 hsa-miR-3133 CLIP-seq
MIRT1040995 hsa-miR-3148 CLIP-seq
MIRT1040996 hsa-miR-3916 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000922 Component Spindle pole IEA
GO:0005515 Function Protein binding IPI 19369198, 20360068, 21516116, 23455924, 25173975, 25281560, 25416956, 26638075, 27107012, 28514442, 29892012, 30723163, 31515488, 32296183, 32814053, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IDA 21399614
GO:0005813 Component Centrosome IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608775 25174 ENSG00000152240
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96CS2
Protein name HAUS augmin-like complex subunit 1 (Coiled-coil domain-containing protein 5) (Enhancer of invasion-cluster) (HEI-C)
Protein function Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.
PDB 7SQK
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in pancreas, kidney, skeletal muscle, liver and heart. Weakly expressed in lung, brain and placenta. {ECO:0000269|PubMed:15082789}.
Sequence
MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQ
KASEYESEAKYLQDLLMESVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPAVN
DLTSDLFRTKSKSEEIKIELEKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQ
NMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLES
YLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL
Sequence length 278
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MIGRAINE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Migraine Disorders Migraine GWASDB_DG 23793025
★☆☆☆☆
Found in Text Mining only
Migraine Disorders Migraine GWASCAT_DG 23793025
★☆☆☆☆
Found in Text Mining only
Obesity Obesity BEFREE 28825674
★☆☆☆☆
Found in Text Mining only